Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-NCF2 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole Cell)

Rabbit NCF2 Polyclonal Antibody | anti-NCF2 antibody

NCF2 Antibody - C-terminal region

Gene Names
NCF2; NCF-2; NOXA2; P67PHOX; P67-PHOX
Reactivity
Cow, Dog, Guinea Pig, Human, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NCF2; Polyclonal Antibody; NCF2 Antibody - C-terminal region; anti-NCF2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TVGDQGFPDEPKESEKADANNQTTEPQLKKGSQVEALFSYEATQPEDLEF
Sequence Length
526
Applicable Applications for anti-NCF2 antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 79%; Guinea Pig: 86%; Human: 100%; Rabbit: 75%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human NCF2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-NCF2 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole Cell)

Western Blot (WB) (WB Suggested Anti-NCF2 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole Cell)
Related Product Information for anti-NCF2 antibody
This is a rabbit polyclonal antibody against NCF2. It was validated on Western Blot

Target Description: This gene encodes neutrophil cytosolic factor 2, the 67-kilodalton cytosolic subunit of the multi-protein NADPH oxidase complex found in neutrophils. This oxidase produces a burst of superoxide which is delivered to the lumen of the neutrophil phagosome. Mutations in this gene, as well as in other NADPH oxidase subunits, can result in chronic granulomatous disease, a disease that causes recurrent infections by catalase-positive organisms.
Product Categories/Family for anti-NCF2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60kDa
NCBI Official Full Name
neutrophil cytosol factor 2 isoform 1
NCBI Official Synonym Full Names
neutrophil cytosolic factor 2
NCBI Official Symbol
NCF2
NCBI Official Synonym Symbols
NCF-2; NOXA2; P67PHOX; P67-PHOX
NCBI Protein Information
neutrophil cytosol factor 2
UniProt Protein Name
Neutrophil cytosol factor 2
Protein Family
UniProt Gene Name
NCF2
UniProt Synonym Gene Names
NOXA2; P67PHOX; NCF-2
UniProt Entry Name
NCF2_HUMAN

NCBI Description

This gene encodes neutrophil cytosolic factor 2, the 67-kilodalton cytosolic subunit of the multi-protein NADPH oxidase complex found in neutrophils. This oxidase produces a burst of superoxide which is delivered to the lumen of the neutrophil phagosome. Mutations in this gene, as well as in other NADPH oxidase subunits, can result in chronic granulomatous disease, a disease that causes recurrent infections by catalase-positive organisms. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jun 2010]

Uniprot Description

p67phox: NCF2, NCF1, and a membrane bound cytochrome b558 are required for activation of the latent NADPH oxidase (necessary for superoxide production). Interacts with SYTL1 and RAC1. Interacts with NCF4. May interact with NOXO1. Belongs to the NCF2/NOXA1 family.

Protein type: Oxidoreductase

Chromosomal Location of Human Ortholog: 1q25

Cellular Component: cytoplasm; nucleolus; acrosome; cytosol; NADPH oxidase complex

Molecular Function: protein C-terminus binding; protein binding; electron carrier activity; Rac GTPase binding

Biological Process: respiratory burst; response to drug; interaction with host; superoxide metabolic process; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent; response to lipopolysaccharide; cellular response to hormone stimulus; antigen processing and presentation of peptide antigen via MHC class I; response to hyperoxia; positive regulation of neuron apoptosis; response to glucose stimulus; innate immune response; antigen processing and presentation of exogenous peptide antigen via MHC class I; cellular defense response; response to activity; response to progesterone stimulus; vascular endothelial growth factor receptor signaling pathway; superoxide release; positive regulation of blood pressure; aging

Disease: Granulomatous Disease, Chronic, Autosomal Recessive, Cytochrome B-positive, Type Ii

Research Articles on NCF2

Similar Products

Product Notes

The NCF2 ncf2 (Catalog #AAA3216381) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NCF2 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Human, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's NCF2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NCF2 ncf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TVGDQGFPDE PKESEKADAN NQTTEPQLKK GSQVEALFSY EATQPEDLEF. It is sometimes possible for the material contained within the vial of "NCF2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.