Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-RTDR1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)

Rabbit RSPH14 Polyclonal Antibody | anti-RSPH14 antibody

RSPH14 Antibody - middle region

Gene Names
RSPH14; RTDR1
Reactivity
Cow, Guinea Pig, Horse, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RSPH14; Polyclonal Antibody; RSPH14 Antibody - middle region; anti-RSPH14 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IARLNATKALTMLAEAPEGRKALQTHVPTFRAMEVETYEKPQVAEALQRA
Sequence Length
348
Applicable Applications for anti-RSPH14 antibody
Western Blot (WB)
Homology
Cow: 79%; Guinea Pig: 79%; Horse: 77%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RTDR1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-RTDR1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)

Western Blot (WB) (WB Suggested Anti-RTDR1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)
Related Product Information for anti-RSPH14 antibody
This is a rabbit polyclonal antibody against RTDR1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene encodes a protein with no known function but with slight similarity to a yeast vacuolar protein. The gene is located in a region deleted in pediatric rhabdoid tumors of the brain, kidney and soft tissues, but mutations in this gene have not been associated with the disease.
Product Categories/Family for anti-RSPH14 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
radial spoke head 14 homolog
NCBI Official Synonym Full Names
radial spoke head 14 homolog
NCBI Official Symbol
RSPH14
NCBI Official Synonym Symbols
RTDR1
NCBI Protein Information
radial spoke head 14 homolog
UniProt Protein Name
Rhabdoid tumor deletion region protein 1
Protein Family
UniProt Gene Name
RTDR1
UniProt Entry Name
RTDR1_HUMAN

NCBI Description

This gene encodes a protein with no known function but with slight similarity to a yeast vacuolar protein. The gene is located in a region deleted in pediatric rhabdoid tumors of the brain, kidney and soft tissues, but mutations in this gene have not been associated with the disease. [provided by RefSeq, Jul 2008]

Similar Products

Product Notes

The RSPH14 rtdr1 (Catalog #AAA3212028) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RSPH14 Antibody - middle region reacts with Cow, Guinea Pig, Horse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's RSPH14 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RSPH14 rtdr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IARLNATKAL TMLAEAPEGR KALQTHVPTF RAMEVETYEK PQVAEALQRA. It is sometimes possible for the material contained within the vial of "RSPH14, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.