Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.45kD).)

Mouse anti-Human DBR1 Monoclonal Antibody | anti-DBR1 antibody

DBR1 (Lariat Debranching Enzyme) (AP)

Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DBR1; Monoclonal Antibody; DBR1 (Lariat Debranching Enzyme) (AP); anti-DBR1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3A7
Specificity
Recognizes human DBR1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-DBR1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa445-539 from human DBR1 (NP_057300) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SGMNTPSVEPSDQASEFSASFSDVRILPGSMIVSSDDTVDSTIDREGKPGGTVESGNGEDLTKVPLKRLSDEHEPEQRKKIKRRNQAIYAAVDD
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.45kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.45kD).)

Western Blot (WB)

(Western Blot analysis of DBR1 expression in transfected 293T cell line by DBR1 monoclonal antibody. Lane 1: DBR1 transfected lysate (61.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of DBR1 expression in transfected 293T cell line by DBR1 monoclonal antibody. Lane 1: DBR1 transfected lysate (61.6kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged DBR1 is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged DBR1 is 0.03ng/ml as a capture antibody.)
Related Product Information for anti-DBR1 antibody
Cleaves the 2'-5' phosphodiester linkage at the branch point of lariat intron pre-mRNAs after splicing and converts them into linear molecules that are subsequently degraded. It thereby facilitates ribonucleotide turnover. It may also participate in retrovirus replication via a RNA lariat intermediate in cDNA synthesis.
Product Categories/Family for anti-DBR1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,022 Da
NCBI Official Full Name
lariat debranching enzyme
NCBI Official Synonym Full Names
debranching RNA lariats 1
NCBI Official Symbol
DBR1
NCBI Protein Information
lariat debranching enzyme; RNA lariat debranching enzyme; debranching enzyme homolog 1
UniProt Protein Name
Lariat debranching enzyme
Protein Family
UniProt Gene Name
DBR1
UniProt Entry Name
DBR1_HUMAN

NCBI Description

The protein encoded by this gene is an RNA lariat debranching enzyme that hydrolyzes 2'-5' prime branched phosphodiester bonds. The encoded protein specifically targets the bonds at the branch point of excised lariat intron RNA, converting them to linear molecules that are then degraded. This protein may also be involved in retroviral replication. [provided by RefSeq, Nov 2011]

Uniprot Description

DBR1: Cleaves the 2'-5' phosphodiester linkage at the branch point of lariat intron pre-mRNAs after splicing and converts them into linear molecules that are subsequently degraded. It thereby facilitates ribonucleotide turnover. It may also participate in retrovirus replication via a RNA lariat intermediate in cDNA synthesis. Belongs to the lariat debranching enzyme family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: RNA splicing; Hydrolase; RNA processing; EC 3.1.-.-

Chromosomal Location of Human Ortholog: 3q22.3

Cellular Component: nucleus

Molecular Function: RNA lariat debranching enzyme activity; metal ion binding

Biological Process: RNA splicing, via transesterification reactions; nuclear mRNA splicing, via spliceosome

Research Articles on DBR1

Similar Products

Product Notes

The DBR1 dbr1 (Catalog #AAA6130869) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DBR1 (Lariat Debranching Enzyme) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DBR1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DBR1 dbr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DBR1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.