Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-LCMT2 Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysateLCMT2 is supported by BioGPS gene expression data to be expressed in HeLa)

Rabbit LCMT2 Polyclonal Antibody | anti-LCMT2 antibody

LCMT2 antibody - C-terminal region

Gene Names
LCMT2; PPM2; TYW4
Reactivity
Cow, Dog, Horse, Human, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LCMT2; Polyclonal Antibody; LCMT2 antibody - C-terminal region; anti-LCMT2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PVLSDWHFLHVGTMAWVRIPVEGEVPEARHSHSACTWQGGALIAGGLGAS
Sequence Length
686
Applicable Applications for anti-LCMT2 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 86%; Horse: 86%; Human: 100%; Pig: 86%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human LCMT2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-LCMT2 Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysateLCMT2 is supported by BioGPS gene expression data to be expressed in HeLa)

Western Blot (WB) (WB Suggested Anti-LCMT2 Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysateLCMT2 is supported by BioGPS gene expression data to be expressed in HeLa)
Related Product Information for anti-LCMT2 antibody
This is a rabbit polyclonal antibody against LCMT2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: LCMT2 belongs to the highly variable methyltransferase superfamily. This gene is the inferred homolog of the Saccharomyces cerevisiae carboxymethyltransferase gene PPM2 that is essential for the synthesis of the hypermodified guanosine Wybutosine (yW). The protein encoded by this intronless gene belongs to the highly variable methyltransferase superfamily. This gene is the inferred homolog of the Saccharomyces cerevisiae carboxymethyltransferase gene PPM2 that is essential for the synthesis of the hypermodified guanosine Wybutosine (yW).
Product Categories/Family for anti-LCMT2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
75kDa
NCBI Official Full Name
tRNA wybutosine-synthesizing protein 4
NCBI Official Synonym Full Names
leucine carboxyl methyltransferase 2
NCBI Official Symbol
LCMT2
NCBI Official Synonym Symbols
PPM2; TYW4
NCBI Protein Information
tRNA wybutosine-synthesizing protein 4
UniProt Protein Name
tRNA wybutosine-synthesizing protein 4
UniProt Gene Name
LCMT2
UniProt Synonym Gene Names
KIAA0547; TYW4; tRNA yW-synthesizing protein 4
UniProt Entry Name
TYW4_HUMAN

NCBI Description

The protein encoded by this intronless gene belongs to the highly variable methyltransferase superfamily. This gene is the inferred homolog of the Saccharomyces cerevisiae carboxymethyltransferase gene PPM2 that is essential for the synthesis of the hypermodified guanosine Wybutosine (yW). [provided by RefSeq, Jul 2008]

Uniprot Description

LCMT2: Probable S-adenosyl-L-methionine-dependent methyltransferase that acts as a component of the wybutosine biosynthesis pathway. Wybutosine is a hyper modified guanosine with a tricyclic base found at the 3'-position adjacent to the anticodon of eukaryotic phenylalanine tRNA. May methylate the carboxyl group of leucine residues to form alpha- leucine ester residues. Belongs to the methyltransferase superfamily. LCMT family.

Protein type: Lipid Metabolism - androgen and estrogen; Amino Acid Metabolism - histidine; Methyltransferase; Amino Acid Metabolism - tyrosine; EC 2.3.1.231; EC 2.1.1.290; Other Amino Acids Metabolism - selenoamino acid

Chromosomal Location of Human Ortholog: 15q15.3

Molecular Function: methyltransferase activity; protein binding

Biological Process: methylation; tRNA processing

Research Articles on LCMT2

Similar Products

Product Notes

The LCMT2 lcmt2 (Catalog #AAA3209159) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LCMT2 antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's LCMT2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LCMT2 lcmt2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PVLSDWHFLH VGTMAWVRIP VEGEVPEARH SHSACTWQGG ALIAGGLGAS. It is sometimes possible for the material contained within the vial of "LCMT2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.