Western Blot (WB)
(WB Suggested Anti-LBR Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: RPMI 8226 cell lysateLBR is supported by BioGPS gene expression data to be expressed in RPMI 8226)
Rabbit LBR Polyclonal Antibody | anti-LBR antibody
LBR antibody - middle region
Gene Names
LBR; PHA; C14SR; LMN2R; PHASK; TDRD18; DHCR14B
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LBR; Polyclonal Antibody; LBR antibody - middle region; anti-LBR antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GANSQKNAFRKNPSDPKLAHLKTIHTSTGKNLLVSGWWGFVRHPNYLGDL
Sequence Length
615
Applicable Applications for anti-LBR antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 100%; Yeast: 77%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human LBR
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-LBR Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: RPMI 8226 cell lysateLBR is supported by BioGPS gene expression data to be expressed in RPMI 8226)
Western Blot (WB)
(WB Suggested Anti-LBR Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: RPMI 8226 cell lysateLBR is supported by BioGPS gene expression data to be expressed in RPMI 8226)
Related Product Information for anti-LBR antibody
This is a rabbit polyclonal antibody against LBR. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The protein encoded by this gene belongs to the ERG4/ERG24 family. It localized in the nuclear envelope inner membrane and anchors the lamina and the heterochromatin to the membrane. It may mediate interaction between chromatin and lamin B. Mutations of this gene has been associated with autosomal recessive HEM/Greenberg skeletal dysplasia. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified.
Target Description: The protein encoded by this gene belongs to the ERG4/ERG24 family. It localized in the nuclear envelope inner membrane and anchors the lamina and the heterochromatin to the membrane. It may mediate interaction between chromatin and lamin B. Mutations of this gene has been associated with autosomal recessive HEM/Greenberg skeletal dysplasia. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified.
Product Categories/Family for anti-LBR antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
71kDa
NCBI Official Full Name
delta(14)-sterol reductase
NCBI Official Synonym Full Names
lamin B receptor
NCBI Official Symbol
LBR
NCBI Official Synonym Symbols
PHA; C14SR; LMN2R; PHASK; TDRD18; DHCR14B
NCBI Protein Information
delta(14)-sterol reductase; lamin-B receptor
UniProt Protein Name
Lamin-B receptor
Protein Family
UniProt Gene Name
LBR
NCBI Description
The protein encoded by this gene belongs to the ERG4/ERG24 family. It localized in the nuclear envelope inner membrane and anchors the lamina and the heterochromatin to the membrane. It may mediate interaction between chromatin and lamin B. Mutations of this gene has been associated with autosomal recessive HEM/Greenberg skeletal dysplasia. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008]
Uniprot Description
Anchors the lamina and the heterochromatin to the inner nuclear membrane.
Research Articles on LBR
Similar Products
Product Notes
The LBR lbr (Catalog #AAA3207700) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LBR antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's LBR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LBR lbr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GANSQKNAFR KNPSDPKLAH LKTIHTSTGK NLLVSGWWGF VRHPNYLGDL. It is sometimes possible for the material contained within the vial of "LBR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
