Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CEP135 AntibodyTitration: 1.0 ug/mlPositive Control: A549 Whole Cell)

Rabbit CEP135 Polyclonal Antibody | anti-CEP135 antibody

CEP135 Antibody - N-terminal region

Gene Names
CEP135; CEP4; MCPH8; KIAA0635
Reactivity
Cow, Dog, Horse, Human, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CEP135; Polyclonal Antibody; CEP135 Antibody - N-terminal region; anti-CEP135 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: REHSDQHVKELKTSLKKCARETADLKFLNNQYAHKLKLLEKESKAKNERI
Sequence Length
1140
Applicable Applications for anti-CEP135 antibody
Western Blot (WB)
Homology
Cow: 77%; Dog: 77%; Horse: 85%; Human: 100%; Pig: 77%; Rabbit: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CEP135
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CEP135 AntibodyTitration: 1.0 ug/mlPositive Control: A549 Whole Cell)

Western Blot (WB) (WB Suggested Anti-CEP135 AntibodyTitration: 1.0 ug/mlPositive Control: A549 Whole Cell)
Related Product Information for anti-CEP135 antibody
This is a rabbit polyclonal antibody against CEP135. It was validated on Western Blot

Target Description: CEP135 is a centrosomal protein involved in centriole biogenesis. CEP135 acts as a scaffolding protein during early centriole biogenesis. CEP135 is also required for centriole-centriole cohesion during interphase by acting as a platform protein for CEP250 at the centriole.
Product Categories/Family for anti-CEP135 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
133kDa
NCBI Official Full Name
centrosomal protein of 135 kDa
NCBI Official Synonym Full Names
centrosomal protein 135
NCBI Official Symbol
CEP135
NCBI Official Synonym Symbols
CEP4; MCPH8; KIAA0635
NCBI Protein Information
centrosomal protein of 135 kDa
UniProt Protein Name
Centrosomal protein of 135 kDa
Protein Family
UniProt Gene Name
CEP135
UniProt Synonym Gene Names
CEP4; KIAA0635; Cep135
UniProt Entry Name
CP135_HUMAN

NCBI Description

This gene encodes a centrosomal protein, which acts as a scaffolding protein during early centriole biogenesis, and is also required for centriole-centriole cohesion during interphase. Mutations in this gene are associated with autosomal recessive primary microcephaly-8. [provided by RefSeq, Jun 2012]

Uniprot Description

CEP135: Centrosomal protein involved in centriole biogenesis. Acts as a scaffolding protein during early centriole biogenesis. Also required for centriole-centriole cohesion during interphase by acting as a platform protein for CEP250 at the centriole. Defects in CEP135 are the cause of microcephaly, primary, type 8 (MCPH8). MCPH8 is a disease defined as a head circumference more than 3 standard deviations below the age- related mean. Brain weight is markedly reduced and the cerebral cortex is disproportionately small. Despite this marked reduction in size, the gyral pattern is relatively well preserved, with no major abnormality in cortical architecture. Affected individuals are mentally retarded. Primary microcephaly is further defined by the absence of other syndromic features or significant neurological deficits due to degenerative brain disorder. Belongs to the CEP135/TSGA10 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 4q12

Cellular Component: centriole; centrosome; cytosol

Molecular Function: protein C-terminus binding; protein binding

Biological Process: organelle organization and biogenesis; centriole replication; mitotic cell cycle; G2/M transition of mitotic cell cycle; centriole-centriole cohesion

Disease: Microcephaly 8, Primary, Autosomal Recessive

Research Articles on CEP135

Similar Products

Product Notes

The CEP135 cep135 (Catalog #AAA3216847) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CEP135 Antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's CEP135 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CEP135 cep135 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: REHSDQHVKE LKTSLKKCAR ETADLKFLNN QYAHKLKLLE KESKAKNERI. It is sometimes possible for the material contained within the vial of "CEP135, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.