Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-LBP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: THP-1 cell lysate)

Rabbit LBP Polyclonal Antibody | anti-LBP antibody

LBP antibody - middle region

Gene Names
LBP; BPIFD2
Reactivity
Dog, Horse, Human, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LBP; Polyclonal Antibody; LBP antibody - middle region; anti-LBP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Horse, Human, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LLGSESSGRPTVTASSCSSDIADVEVDMSGDLGWLLNLFHNQIESKFQKV
Sequence Length
481
Applicable Applications for anti-LBP antibody
Western Blot (WB)
Homology
Dog: 79%; Horse: 86%; Human: 100%; Pig: 86%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human LBP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-LBP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: THP-1 cell lysate)

Western Blot (WB) (WB Suggested Anti-LBP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: THP-1 cell lysate)
Related Product Information for anti-LBP antibody
This is a rabbit polyclonal antibody against LBP. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: LBP is involved in the acute-phase immunologic response to gram-negative bacterial infections. Gram-negative bacteria contain a glycolipid, lipopolysaccharide (LPS), on their outer cell wall. Together with bactericidal permeability-increasing protein (BPI

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51kDa
NCBI Official Full Name
lipopolysaccharide-binding protein
NCBI Official Synonym Full Names
lipopolysaccharide binding protein
NCBI Official Symbol
LBP
NCBI Official Synonym Symbols
BPIFD2
NCBI Protein Information
lipopolysaccharide-binding protein
UniProt Protein Name
Lipopolysaccharide-binding protein
UniProt Gene Name
LBP
UniProt Synonym Gene Names
LBP
UniProt Entry Name
LBP_HUMAN

NCBI Description

The protein encoded by this gene is involved in the acute-phase immunologic response to gram-negative bacterial infections. Gram-negative bacteria contain a glycolipid, lipopolysaccharide (LPS), on their outer cell wall. Together with bactericidal permeability-increasing protein (BPI), the encoded protein binds LPS and interacts with the CD14 receptor, probably playing a role in regulating LPS-dependent monocyte responses. Studies in mice suggest that the encoded protein is necessary for the rapid acute-phase response to LPS but not for the clearance of LPS from circulation. This protein is part of a family of structurally and functionally related proteins, including BPI, plasma cholesteryl ester transfer protein (CETP), and phospholipid transfer protein (PLTP). [provided by RefSeq, Apr 2012]

Uniprot Description

LBP: Binds to the lipid A moiety of bacterial lipopolysaccharides (LPS), a glycolipid present in the outer membrane of all Gram-negative bacteria. The LBP/LPS complex seems to interact with the CD14 receptor. Belongs to the BPI/LBP/Plunc superfamily. BPI/LBP family.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 20q11.23

Cellular Component: extracellular space; cell surface; extracellular region

Molecular Function: protein binding; lipopolysaccharide binding; receptor binding

Biological Process: positive regulation of tumor necrosis factor biosynthetic process; detection of molecule of bacterial origin; positive regulation of toll-like receptor 4 signaling pathway; positive regulation of interleukin-6 production; response to lipopolysaccharide; negative regulation of tumor necrosis factor production; positive regulation of tumor necrosis factor production; defense response to Gram-negative bacterium; leukocyte chemotaxis during inflammatory response; positive regulation of chemokine production; positive regulation of interleukin-8 production; lipopolysaccharide transport; defense response to Gram-positive bacterium; macrophage activation during immune response; acute-phase response; toll-like receptor signaling pathway; lipopolysaccharide-mediated signaling pathway; cellular defense response; innate immune response; opsonization; toll-like receptor 4 signaling pathway; positive regulation of macrophage activation

Research Articles on LBP

Similar Products

Product Notes

The LBP lbp (Catalog #AAA3205904) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LBP antibody - middle region reacts with Dog, Horse, Human, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's LBP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LBP lbp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LLGSESSGRP TVTASSCSSD IADVEVDMSG DLGWLLNLFH NQIESKFQKV. It is sometimes possible for the material contained within the vial of "LBP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.