Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- LAR Picoband antibody, MBS177797, Western blottingAll lanes: Anti LAR (MBS177797) at 0.5ug/mlLane 1: HELA Whole Cell Lysate at 40ugLane 2: A431 Whole Cell Lysate at 40ugLane 3: A549 Whole Cell Lysate at 40ugPredicted bind size: 240KDObserved bind size: 240KD )

anti-Human LAR Polyclonal Antibody | anti-LAR antibody

Anti-LAR Antibody

Gene Names
PTPRF; LAR; BNAH2
Reactivity
Human
Applications
Western Blot, Immunohistochemistry
Purity
Immunogen Affinity Purified
Synonyms
LAR; Polyclonal Antibody; Anti-LAR Antibody; Receptor-type tyrosine-protein phosphatase F; FLJ43335; FLJ45062; FLJ45567; LAR protein; LARFN5C; LARS; LCA homolog; Leukocyte antigen related (LAR) PTP receptor; Leukocyte antigen related; Leukocyte antigen related PTP receptor; Leukocyte antigen related tyrosine phosphatase; Leukocyte common antigen related; Protein Tyrosine Phosphatase Receptor Type F; Protein tyrosine phosphatase receptor type F polypeptide; Ptprf; PTPRF protein; PTPRF_HUMAN; Receptor linked protein tyrosine phosphatase LAR; Receptor type tyrosine protein phosphatase F; Receptor type tyrosine protein phosphatase F precursor; protein tyrosine phosphatase; receptor type; F; anti-LAR antibody
Ordering
For Research Use Only!
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
1907
Applicable Applications for anti-LAR antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human LAR (1167-1203aa EQGGEEQRRRRRQAERLKPYVAAQLDVLPETFTLGDK), different from the related mouse and rat sequences by four amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- LAR Picoband antibody, MBS177797, Western blottingAll lanes: Anti LAR (MBS177797) at 0.5ug/mlLane 1: HELA Whole Cell Lysate at 40ugLane 2: A431 Whole Cell Lysate at 40ugLane 3: A549 Whole Cell Lysate at 40ugPredicted bind size: 240KDObserved bind size: 240KD )

Western Blot (WB) (Anti- LAR Picoband antibody, MBS177797, Western blottingAll lanes: Anti LAR (MBS177797) at 0.5ug/mlLane 1: HELA Whole Cell Lysate at 40ugLane 2: A431 Whole Cell Lysate at 40ugLane 3: A549 Whole Cell Lysate at 40ugPredicted bind size: 240KDObserved bind size: 240KD )

Immunohistochemistry (IHC)

(Anti- LAR Picoband antibody, MBS177797, IHC(P)IHC(P): Human Lung Cancer Tissue )

Immunohistochemistry (IHC) (Anti- LAR Picoband antibody, MBS177797, IHC(P)IHC(P): Human Lung Cancer Tissue )
Related Product Information for anti-LAR antibody
Description: Rabbit IgG polyclonal antibody for Receptor-type tyrosine-protein phosphatase F(PTPRF) detection. Tested with WB, IHC-P in Human.

Background: Receptor-type tyrosine-protein phosphatase F is an enzyme that in humans is encoded by the PTPRF gene. The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and two tandem intracytoplasmic catalytic domains, and thus represents a receptor-type PTP. The extracellular region contains three Ig-like domains, and nine non-Ig like domains similar to that of neural-cell adhesion molecule. This PTP was shown to function in the regulation of epithelial cell-cell contacts at adherents junctions, as well as in the control of beta-catenin signaling. An increased expression level of this protein was found in the insulin-responsive tissue of obese, insulin-resistant individuals, and may contribute to the pathogenesis of insulin resistance. Two alternatively spliced transcript variants of this gene, which encode distinct proteins, have been reported.
References
1. "Entrez Gene: PTPRF protein tyrosine phosphatase, receptor type, F". 2. Harder KW, Saw J, Miki N, Jirik F (Nov 1995). "Coexisting amplifications of the chromosome 1p32 genes (PTPRF and MYCL1) encoding protein tyrosine phosphatase LAR and L-myc in a small cell lung cancer line".Genomics 27 (3): 552-3.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
211,687 Da
NCBI Official Full Name
receptor-type tyrosine-protein phosphatase F isoform 1
NCBI Official Synonym Full Names
protein tyrosine phosphatase, receptor type F
NCBI Official Symbol
PTPRF
NCBI Official Synonym Symbols
LAR; BNAH2
NCBI Protein Information
receptor-type tyrosine-protein phosphatase F
UniProt Protein Name
Receptor-type tyrosine-protein phosphatase F
Protein Family
UniProt Gene Name
PTPRF
UniProt Synonym Gene Names
LAR; LAR
UniProt Entry Name
PTPRF_HUMAN

NCBI Description

The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and two tandem intracytoplasmic catalytic domains, and thus represents a receptor-type PTP. The extracellular region contains three Ig-like domains, and nine non-Ig like domains similar to that of neural-cell adhesion molecule. This PTP was shown to function in the regulation of epithelial cell-cell contacts at adherents junctions, as well as in the control of beta-catenin signaling. An increased expression level of this protein was found in the insulin-responsive tissue of obese, insulin-resistant individuals, and may contribute to the pathogenesis of insulin resistance. Two alternatively spliced transcript variants of this gene, which encode distinct proteins, have been reported. [provided by RefSeq, Jul 2008]

Uniprot Description

Possible cell adhesion receptor. It possesses an intrinsic protein tyrosine phosphatase activity (PTPase) and dephosphorylates EPHA2 regulating its activity.

Research Articles on LAR

Similar Products

Product Notes

The LAR ptprf (Catalog #AAA177797) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-LAR Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LAR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC) Paraffin. Western Blot Concentration: 0.1-0.5ug/ml Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml. Researchers should empirically determine the suitability of the LAR ptprf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LAR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.