anti-Human LAR Polyclonal Antibody | anti-LAR antibody

Anti-LAR Antibody

Cat. Num. AAA177797

• Gene Names: PTPRF; LAR; BNAH2
• Reactivity: Human
• Applications: Western Blot, Immunohistochemistry
• Purity: Immunogen Affinity Purified
• Synonyms: LAR; Polyclonal Antibody; Anti-LAR Antibody; Receptor-type tyrosine-protein phosphatase F; FLJ43335; FLJ45062; FLJ45567; LAR protein; LARFN5C; LARS; LCA homolog; Leukocyte antigen related (LAR) PTP receptor; Leukocyte antigen related; Leukocyte antigen related PTP receptor; Leukocyte antigen related tyrosine phosphatase; Leukocyte common antigen related; Protein Tyrosine Phosphatase Receptor Type F; Protein tyrosine phosphatase receptor type F polypeptide; Ptprf; PTPRF protein; PTPRF_HUMAN; Receptor linked protein tyrosine phosphatase LAR; Receptor type tyrosine protein phosphatase F; Receptor type tyrosine protein phosphatase F precursor; protein tyrosine phosphatase; receptor type; F; anti-LAR antibody

• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 1907

• Applicable Applications for anti-LAR antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin
• Application Notes: Western Blot Concentration: 0.1-0.5ug/ml; Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human LAR (1167-1203aa EQGGEEQRRRRRQAERLKPYVAAQLDVLPETFTLGDK), different from the related mouse and rat sequences by four amino acids.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- LAR Picoband antibody, MBS177797, Western blottingAll lanes: Anti LAR (MBS177797) at 0.5ug/mlLane 1: HELA Whole Cell Lysate at 40ugLane 2: A431 Whole Cell Lysate at 40ugLane 3: A549 Whole Cell Lysate at 40ugPredicted bind size: 240KDObserved bind size: 240KD )

Immunohistochemistry (IHC)

(Anti- LAR Picoband antibody, MBS177797, IHC(P)IHC(P): Human Lung Cancer Tissue )

Related Product Information for anti-LAR antibody

Description: Rabbit IgG polyclonal antibody for Receptor-type tyrosine-protein phosphatase F(PTPRF) detection. Tested with WB, IHC-P in Human.

Background: Receptor-type tyrosine-protein phosphatase F is an enzyme that in humans is encoded by the PTPRF gene. The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and two tandem intracytoplasmic catalytic domains, and thus represents a receptor-type PTP. The extracellular region contains three Ig-like domains, and nine non-Ig like domains similar to that of neural-cell adhesion molecule. This PTP was shown to function in the regulation of epithelial cell-cell contacts at adherents junctions, as well as in the control of beta-catenin signaling. An increased expression level of this protein was found in the insulin-responsive tissue of obese, insulin-resistant individuals, and may contribute to the pathogenesis of insulin resistance. Two alternatively spliced transcript variants of this gene, which encode distinct proteins, have been reported.

References

1. "Entrez Gene: PTPRF protein tyrosine phosphatase, receptor type, F". 2. Harder KW, Saw J, Miki N, Jirik F (Nov 1995). "Coexisting amplifications of the chromosome 1p32 genes (PTPRF and MYCL1) encoding protein tyrosine phosphatase LAR and L-myc in a small cell lung cancer line".Genomics 27 (3): 552-3.

NCBI and Uniprot Product Information

• NCBI GI #: 109633041
• NCBI GeneID: 5792
• NCBI Accession #: NP_002831.2
• NCBI GenBank Nucleotide #: NM_002840.3
• UniProt Accession #: P10586; Q5T021; Q5T022; Q5W9G2; Q86WS0; D3DPX6; D3DPX7
• Molecular Weight: 211,687 Da
• NCBI Official Full Name: receptor-type tyrosine-protein phosphatase F isoform 1
• NCBI Official Synonym Full Names: protein tyrosine phosphatase, receptor type F
• NCBI Official Symbol: PTPRF
• NCBI Official Synonym Symbols: LAR; BNAH2
• NCBI Protein Information: receptor-type tyrosine-protein phosphatase F
• UniProt Protein Name: Receptor-type tyrosine-protein phosphatase F
• Protein Family: Large T antigen
• UniProt Gene Name: PTPRF
• UniProt Synonym Gene Names: LAR; LAR
• UniProt Entry Name: PTPRF_HUMAN

NCBI Description

The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and two tandem intracytoplasmic catalytic domains, and thus represents a receptor-type PTP. The extracellular region contains three Ig-like domains, and nine non-Ig like domains similar to that of neural-cell adhesion molecule. This PTP was shown to function in the regulation of epithelial cell-cell contacts at adherents junctions, as well as in the control of beta-catenin signaling. An increased expression level of this protein was found in the insulin-responsive tissue of obese, insulin-resistant individuals, and may contribute to the pathogenesis of insulin resistance. Two alternatively spliced transcript variants of this gene, which encode distinct proteins, have been reported. [provided by RefSeq, Jul 2008]

Uniprot Description

Possible cell adhesion receptor. It possesses an intrinsic protein tyrosine phosphatase activity (PTPase) and dephosphorylates EPHA2 regulating its activity.