Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-KIF1A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: THP-1 cell lysate)

Rabbit KIF1A Polyclonal Antibody | anti-KIF1A antibody

KIF1A antibody - N-terminal region

Gene Names
KIF1A; ATSV; MRD9; HSN2C; SPG30; UNC104; C2orf20
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
KIF1A; Polyclonal Antibody; KIF1A antibody - N-terminal region; anti-KIF1A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQH
Sequence Length
1690
Applicable Applications for anti-KIF1A antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 79%; Rat: 100%; Yeast: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human KIF1A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-KIF1A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: THP-1 cell lysate)

Western Blot (WB) (WB Suggested Anti-KIF1A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: THP-1 cell lysate)
Related Product Information for anti-KIF1A antibody
This is a rabbit polyclonal antibody against KIF1A. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: KIF1A is the motor for anterograde axonal transport of synaptic vesicle precursors.The protein encoded by this gene is a member of the kinesin family. This protein is highly similar to mouse heavy chain kinesin member 1A protein which is an anterograde motor protein that transports membranous organelles along axonal microtubules. It is thought that this protein may play a critical role in the development of axonal neuropathies resulting from impaired axonal transport. There are multiple polyadenylation sites found in this gene. Sequence Note: X90840.1 is a chimeric sequence. Only the ATSV region was propagated into this RefSeq record. [6/26/03, RefSeq staff]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-KIF1A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
547
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
191kDa
NCBI Official Full Name
kinesin-like protein KIF1A isoform 2
NCBI Official Synonym Full Names
kinesin family member 1A
NCBI Official Symbol
KIF1A
NCBI Official Synonym Symbols
ATSV; MRD9; HSN2C; SPG30; UNC104; C2orf20
NCBI Protein Information
kinesin-like protein KIF1A
UniProt Protein Name
Kinesin-like protein KIF1A
Protein Family
UniProt Gene Name
KIF1A
UniProt Synonym Gene Names
ATSV; C2orf20; hUnc-104
UniProt Entry Name
KIF1A_HUMAN

NCBI Description

The protein encoded by this gene is a member of the kinesin family and functions as an anterograde motor protein that transports membranous organelles along axonal microtubules. Mutations at this locus have been associated with spastic paraplegia-30 and hereditary sensory neuropathy IIC. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Apr 2012]

Uniprot Description

KIF1A: a member of the kinesin motor protein family. Motor for anterograde axonal transport of synaptic vesicle precursors. Interacts with PPFIA1 and PPFIA4. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Motor; Microtubule-binding

Chromosomal Location of Human Ortholog: 2q37.3

Cellular Component: kinesin complex; microtubule; neuron projection; cell soma; cytoplasm

Molecular Function: plus-end-directed microtubule motor activity; microtubule binding; ATPase activity; motor activity; ATP binding

Biological Process: vesicle-mediated transport; metabolic process; cytoskeleton-dependent intracellular transport; anterograde axon cargo transport; microtubule-based movement

Disease: Neuropathy, Hereditary Sensory, Type Iic; Spastic Paraplegia 30, Autosomal Recessive; Neuropathy, Hereditary Sensory And Autonomic, Type Iia; Mental Retardation, Autosomal Dominant 9

Research Articles on KIF1A

Similar Products

Product Notes

The KIF1A kif1a (Catalog #AAA3201778) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KIF1A antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's KIF1A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KIF1A kif1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TTIVNPKQPK ETPKSFSFDY SYWSHTSPED INYASQKQVY RDIGEEMLQH. It is sometimes possible for the material contained within the vial of "KIF1A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.