Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (GK rabbit polyclonal antibody. Western Blot analysis of GK expression in human liver.)

Rabbit anti-Human Glycerol Kinase Polyclonal Antibody | anti-GK antibody

Glycerol Kinase (ATP:Glycerol 3-phosphotransferase, GK, GK1, GKD, Glycerokinase) APC

Gene Names
GK; GK1; GKD
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Glycerol Kinase; Polyclonal Antibody; Glycerol Kinase (ATP:Glycerol 3-phosphotransferase; GK; GK1; GKD; Glycerokinase) APC; anti-GK antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human GK.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-GK antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human GK, aa1-524 (NP_000158.1).
Immunogen Sequence
MAASKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEILHSVYECIEKTCEKLGQLNIDISNIKAIGVSNQRETTVVWDKITGEPLYNAVVWLDLRTQSTVESLSKRIPGNNNFVKSKTGLPLSTYFSAVKLRWLLDNVRKVQKAVEEKRALFGTIDSWLIWSLTGGVNGGVHCTDVTNASRTMLFNIHSLEWDKQLCEFFGIPMEILPNVRSSSEIYGLMKAGALEGVPISGCLGDQSAALVGQMCFQIGQAKNTYGTGCFLLCNTGHKCVFSDHGLLTTVAYKLGRDKPVYYALEGSVAIAGAVIRWLRDNLGIIKTSEEIEKLAKEVGTSYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLSHLQVDGGMTSNKILMQLQADILYIPVVKPSMPETTALGAAMAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKSMGWVTTQSPESGIP
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(GK rabbit polyclonal antibody. Western Blot analysis of GK expression in human liver.)

Western Blot (WB) (GK rabbit polyclonal antibody. Western Blot analysis of GK expression in human liver.)

Western Blot (WB)

(Western Blot analysis of GK expression in transfected 293T cell line by GK polyclonal antibody. Lane 1: GK transfected lysate (57.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GK expression in transfected 293T cell line by GK polyclonal antibody. Lane 1: GK transfected lysate (57.5kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-GK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61,245 Da
NCBI Official Full Name
glycerol kinase isoform b
NCBI Official Synonym Full Names
glycerol kinase
NCBI Official Symbol
GK
NCBI Official Synonym Symbols
GK1; GKD
NCBI Protein Information
glycerol kinase; glycerokinase; ATP:glycerol 3-phosphotransferase
UniProt Protein Name
Glycerol kinase
Protein Family
UniProt Gene Name
GK
UniProt Synonym Gene Names
GK
UniProt Entry Name
GLPK_HUMAN

NCBI Description

The protein encoded by this gene belongs to the FGGY kinase family. This protein is a key enzyme in the regulation of glycerol uptake and metabolism. It catalyzes the phosphorylation of glycerol by ATP, yielding ADP and glycerol-3-phosphate. Mutations in this gene are associated with glycerol kinase deficiency (GKD). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2011]

Uniprot Description

GLPK: Key enzyme in the regulation of glycerol uptake and metabolism. Defects in GK are the cause of GK deficiency (GKD). This disease can be either symptomatic with episodic metabolic and CNS decompensation or asymptomatic with hyperglycerolemia and hyperglyceroluria only. Belongs to the FGGY kinase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Mitochondrial; Lipid Metabolism - glycerolipid; EC 2.7.1.30; Kinase, other

Chromosomal Location of Human Ortholog: Xp21.3

Cellular Component: mitochondrial outer membrane; nucleus; cytosol

Molecular Function: glycerol kinase activity; protein binding; ATP binding

Biological Process: triacylglycerol metabolic process; glycerol metabolic process; triacylglycerol biosynthetic process; cellular lipid metabolic process; glucose homeostasis; phosphorylation; glycerol-3-phosphate biosynthetic process; glycerol catabolic process

Disease: Glycerol Kinase Deficiency

Research Articles on GK

Similar Products

Product Notes

The GK gk (Catalog #AAA6379935) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Glycerol Kinase (ATP:Glycerol 3-phosphotransferase, GK, GK1, GKD, Glycerokinase) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Glycerol Kinase can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GK gk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Glycerol Kinase, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.