Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of BCL7B expression in transfected 293T cell line by BCL7B polyclonal antibody. Lane 1: BCL7B transfected lysate (22.2kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human BCL7B Polyclonal Antibody | anti-BCL7B antibody

BCL7B (B-cell CLL/Lymphoma 7 Protein Family Member B, Allergen=Hom s 3)

Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
BCL7B; Polyclonal Antibody; BCL7B (B-cell CLL/Lymphoma 7 Protein Family Member B; Allergen=Hom s 3); Anti -BCL7B (B-cell CLL/Lymphoma 7 Protein Family Member B; anti-BCL7B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human BCL7B.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MSGRSVRAETRSRAKDDIKKVMAAIEKVRKWEKKWVTVGDTSLRIFKWVPVTDSKEKEKSKSNSSAAREPNGFPSDASANSSLLLEFQDENSNQSSVSDVYQLKVDSSTNSSPSPQQSESLSPAHTSDFRTDDSQPPTLGQEILEEPSLPSSEVADEPPTLTKEEPVPLETQVVEEEEDSGAPPLKRFCVDQPTVPQTASES
Applicable Applications for anti-BCL7B antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human BCL7B, aa1-202 (NP_001698.2)
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of BCL7B expression in transfected 293T cell line by BCL7B polyclonal antibody. Lane 1: BCL7B transfected lysate (22.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of BCL7B expression in transfected 293T cell line by BCL7B polyclonal antibody. Lane 1: BCL7B transfected lysate (22.2kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-BCL7B antibody
May play a role in lung tumor development or progression.
Product Categories/Family for anti-BCL7B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,195 Da
NCBI Official Full Name
B-cell CLL/lymphoma 7 protein family member B isoform 2
NCBI Official Synonym Full Names
B-cell CLL/lymphoma 7B
NCBI Official Symbol
BCL7B
NCBI Protein Information
B-cell CLL/lymphoma 7 protein family member B
UniProt Protein Name
B-cell CLL/lymphoma 7 protein family member B
UniProt Gene Name
BCL7B
UniProt Entry Name
BCL7B_HUMAN

NCBI Description

This gene encodes a member of the BCL7 family including BCL7A, BCL7B and BCL7C proteins. This member is BCL7B, which contains a region that is highly similar to the N-terminal segment of BCL7A or BCL7C proteins. The BCL7A protein is encoded by the gene known to be directly involved in a three-way gene translocation in a Burkitt lymphoma cell line. This gene is located at a chromosomal region commonly deleted in Williams syndrome. This gene is highly conserved from C. elegans to human. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Oct 2010]

Uniprot Description

Function: May play a role in lung tumor development or progression.

Tissue specificity: Ubiquitous. Ref.2 Ref.3

Involvement in disease: BCL7B is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region. Haploinsufficiency of BCL7B may be the cause of certain cardiovascular and musculo-skeletal abnormalities observed in the disease. Ref.2 Ref.3

Allergenic properties: Causes an allergic reaction in human. Binds to IgE from atopic dermatitis (AD) patients. Identified as an IgE autoantigen in atopic dermatitis (AD) patients with severe skin manifestations. Ref.9

Sequence similarities: Belongs to the BCL7 family.

Research Articles on BCL7B

Similar Products

Product Notes

The BCL7B bcl7b (Catalog #AAA646877) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BCL7B (B-cell CLL/Lymphoma 7 Protein Family Member B, Allergen=Hom s 3) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BCL7B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the BCL7B bcl7b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSGRSVRAET RSRAKDDIKK VMAAIEKVRK WEKKWVTVGD TSLRIFKWVP VTDSKEKEKS KSNSSAAREP NGFPSDASAN SSLLLEFQDE NSNQSSVSDV YQLKVDSSTN SSPSPQQSES LSPAHTSDFR TDDSQPPTLG QEILEEPSLP SSEVADEPPT LTKEEPVPLE TQVVEEEEDS GAPPLKRFCV DQPTVPQTAS ES. It is sometimes possible for the material contained within the vial of "BCL7B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.