Mouse anti-Human KCTD6 Polyclonal Antibody

KCTD6 (BTB/POZ Domain-containing Protein KCTD6, MGC27385)

Cat. Num. AAA6003361

• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: KCTD6; Polyclonal Antibody; KCTD6 (BTB/POZ Domain-containing Protein KCTD6; MGC27385); Anti -KCTD6 (BTB/POZ Domain-containing Protein KCTD6; anti-KCTD6 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human KCTD6.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MDNGDWGYMMTDPVTLNVGGHLYTTSLTTLTRYPDSMLGAMFGGDFPTARDPQGNYFIDRDGPLFRYVLNFLRTSELTLPLDFKEFDLLRKEADFYQIEPLIQCLNDPKPLYPMDTFEEVVELSSTRKLSKYSNPVAVIITQLTITTKVHSLLEGISNYFTKWNKHMMDTRDCQVSFTFGPCDYHQEVSLRVHLMEYITKQGFTIRNTRVHHMSERANENTVEHNWTFCRLARKTDD

• Applicable Applications for anti-KCTD6 antibody: Western Blot (WB)
• Application Notes: Suitable for use in Western Blot.
• Immunogen: Full length human KCTD6, aa1-237 (AAH22893.2).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of KCTD6 expression in transfected 293T cell line by KCTD6 polyclonal antibody. Lane 1: KCTD6 transfected lysate (26.07kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-KCTD6 antibody

KCTD6 is a domain of a potassium channel.

Product Categories/Family for anti-KCTD6 antibody

Antibodies; Abs to Ion Channel