Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of CYB5R2 expression in transfected 293T cell line by CYB5R2 polyclonal antibody. Lane 1: CYB5R2 transfected lysate (26.07kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human CYB5R2 Polyclonal Antibody | anti-CYB5R2 antibody

CYB5R2 (NADH-cytochrome b5 Reductase 2, b5R.2)

Gene Names
CYB5R2; B5R.2
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
CYB5R2; Polyclonal Antibody; CYB5R2 (NADH-cytochrome b5 Reductase 2; b5R.2); Anti -CYB5R2 (NADH-cytochrome b5 Reductase 2; anti-CYB5R2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CYB5R2.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MNSRRREPITLQDPEAKYPLPLIEKEKISHNTRRFRFGLPSPDHVLGLPVGNYVQLLAKIDNELVVRAYTPVSSDDDRGFVDLIIKIYFKNVHPQYPEGGKMTQYLENMKIGETIFFRGPRGRLFYHGPGNLGIRPDQTSEPKKTLADHLGMIAGGTGITPMLQLIRHITKDPSDRTRMSLIFANQTEEDILVRKELEEIARTHPDQFDLWYTLDRPPIGPWSAEGATLLSNSAQFH
Applicable Applications for anti-CYB5R2 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human CYB5R2, aa1-237, (AAH01346.1, 51700).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CYB5R2 expression in transfected 293T cell line by CYB5R2 polyclonal antibody. Lane 1: CYB5R2 transfected lysate (26.07kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CYB5R2 expression in transfected 293T cell line by CYB5R2 polyclonal antibody. Lane 1: CYB5R2 transfected lysate (26.07kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CYB5R2 antibody
NADH-cytochrome b5 reductases are involved in desaturation and elongation of fatty acids, cholesterol biosynthesis, drug metabolism, and, in erythrocyte, methemoglobin reduction. Responsible for NADH-dependent lucigenin chemiluminescence in spermatozoa by reducing both lucigenin and 2-[4-iodophenyl]-3-[4-nitrophenyl]-5-[2,4-disulfophenyl]-2H tetrazolium monosodium salt (WST-1).
Product Categories/Family for anti-CYB5R2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
31,458 Da
NCBI Official Full Name
CYB5R2 protein
NCBI Official Synonym Full Names
cytochrome b5 reductase 2
NCBI Official Symbol
CYB5R2
NCBI Official Synonym Symbols
B5R.2
NCBI Protein Information
NADH-cytochrome b5 reductase 2; cytochrome b5 reductase b5R.2
UniProt Protein Name
NADH-cytochrome b5 reductase 2
UniProt Gene Name
CYB5R2
UniProt Synonym Gene Names
b5R.2
UniProt Entry Name
NB5R2_HUMAN

NCBI Description

The protein encoded by this gene belongs to the flavoprotein pyridine nucleotide cytochrome reductase family of proteins. Cytochrome b-type NAD(P)H oxidoreductases are implicated in many processes including cholesterol biosynthesis, fatty acid desaturation and elongation, and respiratory burst in neutrophils and macrophages. Cytochrome b5 reductases have soluble and membrane-bound forms that are the product of alternative splicing. In animal cells, the membrane-bound form binds to the endoplasmic reticulum, where it is a member of a fatty acid desaturation complex. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2014]

Uniprot Description

CYB5R2: NADH-cytochrome b5 reductases are involved in desaturation and elongation of fatty acids, cholesterol biosynthesis, drug metabolism, and, in erythrocyte, methemoglobin reduction. Responsible for NADH-dependent lucigenin chemiluminescence in spermatozoa by reducing both lucigenin and 2-[4-iodophenyl]-3-[4-nitrophenyl]-5-[2,4- disulfophenyl]-2H tetrazolium monosodium salt (WST-1). Belongs to the flavoprotein pyridine nucleotide cytochrome reductase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Oxidoreductase; EC 1.6.2.2

Chromosomal Location of Human Ortholog: 11p15.4

Cellular Component: mitochondrion; membrane; nucleus

Molecular Function: cytochrome-b5 reductase activity

Biological Process: sterol biosynthetic process

Research Articles on CYB5R2

Similar Products

Product Notes

The CYB5R2 cyb5r2 (Catalog #AAA6003451) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CYB5R2 (NADH-cytochrome b5 Reductase 2, b5R.2) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CYB5R2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the CYB5R2 cyb5r2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MNSRRREPIT LQDPEAKYPL PLIEKEKISH NTRRFRFGLP SPDHVLGLPV GNYVQLLAKI DNELVVRAYT PVSSDDDRGF VDLIIKIYFK NVHPQYPEGG KMTQYLENMK IGETIFFRGP RGRLFYHGPG NLGIRPDQTS EPKKTLADHL GMIAGGTGIT PMLQLIRHIT KDPSDRTRMS LIFANQTEED ILVRKELEEI ARTHPDQFDL WYTLDRPPIG PWSAEGATLL SNSAQFH. It is sometimes possible for the material contained within the vial of "CYB5R2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.