Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Kidney)

Rabbit KCNQ1 Polyclonal Antibody | anti-KCNQ1 antibody

KCNQ1 antibody - N-terminal region

Gene Names
KCNQ1; LQT; RWS; WRS; LQT1; SQT2; ATFB1; ATFB3; JLNS1; KCNA8; KCNA9; Kv1.9; Kv7.1; KVLQT1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
KCNQ1; Polyclonal Antibody; KCNQ1 antibody - N-terminal region; anti-KCNQ1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RSKYVGLWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGI
Sequence Length
586
Applicable Applications for anti-KCNQ1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human KCNQ1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Kidney)

Immunohistochemistry (IHC) (Kidney)

Western Blot (WB)

(Host: MouseTarget Name: KCNQ1Sample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: KCNQ1Sample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Lanes:100 ug CHO cell lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Goat anti-rabbit HRPSecondary Antibody Dilution:1:25000Gene Name:KCNQ1Submitted by:Anonymous)

Western Blot (WB) (Lanes:100 ug CHO cell lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Goat anti-rabbit HRPSecondary Antibody Dilution:1:25000Gene Name:KCNQ1Submitted by:Anonymous)

Western Blot (WB)

(WB Suggested Anti-KCNQ1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Liver)

Western Blot (WB) (WB Suggested Anti-KCNQ1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Liver)
Related Product Information for anti-KCNQ1 antibody
This is a rabbit polyclonal antibody against KCNQ1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNG1 is a member of the potassium channel, voltage-gated, subfamily G. Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily G. This gene is abundantly expressed in skeletal muscle. Alternative splicing results in at least two transcript variants encoding distinct isoforms.
Product Categories/Family for anti-KCNQ1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64kDa
NCBI Official Synonym Full Names
potassium voltage-gated channel subfamily Q member 1
NCBI Official Symbol
KCNQ1
NCBI Official Synonym Symbols
LQT; RWS; WRS; LQT1; SQT2; ATFB1; ATFB3; JLNS1; KCNA8; KCNA9; Kv1.9; Kv7.1; KVLQT1
NCBI Protein Information
potassium voltage-gated channel subfamily KQT member 1
UniProt Protein Name
Potassium voltage-gated channel subfamily KQT member 1
UniProt Gene Name
KCNQ1
UniProt Synonym Gene Names
KCNA8; KCNA9; KVLQT1
UniProt Entry Name
KCNQ1_HUMAN

NCBI Description

This gene encodes a voltage-gated potassium channel required for repolarization phase of the cardiac action potential. This protein can form heteromultimers with two other potassium channel proteins, KCNE1 and KCNE3. Mutations in this gene are associated with hereditary long QT syndrome 1 (also known as Romano-Ward syndrome), Jervell and Lange-Nielsen syndrome, and familial atrial fibrillation. This gene exhibits tissue-specific imprinting, with preferential expression from the maternal allele in some tissues, and biallelic expression in others. This gene is located in a region of chromosome 11 amongst other imprinted genes that are associated with Beckwith-Wiedemann syndrome (BWS), and itself has been shown to be disrupted by chromosomal rearrangements in patients with BWS. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Aug 2011]

Research Articles on KCNQ1

Similar Products

Product Notes

The KCNQ1 kcnq1 (Catalog #AAA3202361) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KCNQ1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's KCNQ1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the KCNQ1 kcnq1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RSKYVGLWGR LRFARKPISI IDLIVVVASM VVLCVGSKGQ VFATSAIRGI. It is sometimes possible for the material contained within the vial of "KCNQ1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.