Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using KCNK6 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

Rabbit KCNK6 Polyclonal Antibody | anti-KCNK6 antibody

KCNK6 Rabbit pAb

Gene Names
KCNK6; TOSS; KCNK8; TWIK2; K2p6.1; TWIK-2
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purification
Synonyms
KCNK6; Polyclonal Antibody; KCNK6 Rabbit pAb; K2p6.1; KCNK8; TOSS; TWIK-2; TWIK2; anti-KCNK6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
QTFRHVSDLHGLTELILLPPPCPASFNADEDDRVDILGPQPESHQQLSASSHTDYASIPR
Applicable Applications for anti-KCNK6 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 254-313 of human KCNK6 (NP_004814.1).
Cellular Location
Membrane, Multi-pass membrane protein
Positive Samples
BxPC-3, HT-29, K-562, A-549, 293T, Mouse pancreas, Mouse heart
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using KCNK6 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using KCNK6 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Related Product Information for anti-KCNK6 antibody
Background: This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. This channel protein, considered an open rectifier, is widely expressed. It is stimulated by arachidonic acid, and inhibited by internal acidification and volatile anaesthetics.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33,747 Da
NCBI Official Full Name
potassium channel subfamily K member 6
NCBI Official Synonym Full Names
potassium channel, subfamily K, member 6
NCBI Official Symbol
KCNK6
NCBI Official Synonym Symbols
TOSS; KCNK8; TWIK2; K2p6.1; TWIK-2
NCBI Protein Information
potassium channel subfamily K member 6; K2P6.1 potassium channel; TWIK-originated similarity sequence; TWIK-originated sodium similarity sequence; inward rectifying potassium channel protein TWIK-2
UniProt Protein Name
Potassium channel subfamily K member 6
UniProt Gene Name
KCNK6
UniProt Synonym Gene Names
TOSS; TWIK2
UniProt Entry Name
KCNK6_HUMAN

NCBI Description

This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. This channel protein, considered an open rectifier, is widely expressed. It is stimulated by arachidonic acid, and inhibited by internal acidification and volatile anaesthetics. [provided by RefSeq, Jul 2008]

Uniprot Description

KCNK6: Exhibits outward rectification in a physiological K(+) gradient and mild inward rectification in symmetrical K(+) conditions. Belongs to the two pore domain potassium channel (TC 1.A.1.8) family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 19q13.1

Cellular Component: voltage-gated potassium channel complex; plasma membrane

Molecular Function: inward rectifier potassium channel activity

Biological Process: synaptic transmission; negative regulation of systemic arterial blood pressure; regulation of resting membrane potential; potassium ion transport

Research Articles on KCNK6

Similar Products

Product Notes

The KCNK6 kcnk6 (Catalog #AAA9142177) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KCNK6 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KCNK6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the KCNK6 kcnk6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QTFRHVSDLH GLTELILLPP PCPASFNADE DDRVDILGPQ PESHQQLSAS SHTDYASIPR. It is sometimes possible for the material contained within the vial of "KCNK6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.