Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-KCNK6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Hela cell lysate)

Rabbit KCNK6 Polyclonal Antibody | anti-KCNK6 antibody

KCNK6 antibody - N-terminal region

Gene Names
KCNK6; TOSS; KCNK8; TWIK2; K2p6.1; TWIK-2
Reactivity
Cow, Human, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
KCNK6; Polyclonal Antibody; KCNK6 antibody - N-terminal region; anti-KCNK6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RLGRVVLANASGSANASDPAWDFASALFFASTLITTVGYGYTTPLTDAGK
Sequence Length
313
Applicable Applications for anti-KCNK6 antibody
Western Blot (WB)
Homology
Cow: 100%; Human: 100%; Pig: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the n terminal region of human KCNK6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-KCNK6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Hela cell lysate)

Western Blot (WB) (WB Suggested Anti-KCNK6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Hela cell lysate)
Related Product Information for anti-KCNK6 antibody
This is a rabbit polyclonal antibody against KCNK6. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: KCNK6 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. This channel protein, considered an open rectifier, is widely expressed. It is stimulated by arachidonic acid, and inhibited by internal acidification and volatile anaesthetics.This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. This channel protein, considered an open rectifier, is widely expressed. It is stimulated by arachidonic acid, and inhibited by internal acidification and volatile anaesthetics.
Product Categories/Family for anti-KCNK6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
potassium channel subfamily K member 6
NCBI Official Synonym Full Names
potassium two pore domain channel subfamily K member 6
NCBI Official Symbol
KCNK6
NCBI Official Synonym Symbols
TOSS; KCNK8; TWIK2; K2p6.1; TWIK-2
NCBI Protein Information
potassium channel subfamily K member 6
UniProt Protein Name
Potassium channel subfamily K member 6
UniProt Gene Name
KCNK6
UniProt Synonym Gene Names
TOSS; TWIK2
UniProt Entry Name
KCNK6_HUMAN

NCBI Description

This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. This channel protein, considered an open rectifier, is widely expressed. It is stimulated by arachidonic acid, and inhibited by internal acidification and volatile anaesthetics. [provided by RefSeq, Jul 2008]

Uniprot Description

KCNK6: Exhibits outward rectification in a physiological K(+) gradient and mild inward rectification in symmetrical K(+) conditions. Belongs to the two pore domain potassium channel (TC 1.A.1.8) family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 19q13.1

Cellular Component: voltage-gated potassium channel complex; plasma membrane

Molecular Function: inward rectifier potassium channel activity

Biological Process: synaptic transmission; negative regulation of systemic arterial blood pressure; regulation of resting membrane potential; potassium ion transport

Research Articles on KCNK6

Similar Products

Product Notes

The KCNK6 kcnk6 (Catalog #AAA3203285) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KCNK6 antibody - N-terminal region reacts with Cow, Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's KCNK6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KCNK6 kcnk6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RLGRVVLANA SGSANASDPA WDFASALFFA STLITTVGYG YTTPLTDAGK. It is sometimes possible for the material contained within the vial of "KCNK6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.