Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RatTarget Name: KCND3Sample Tissue: Rat LiverAntibody Dilution: 1ug/ml)

Rabbit KCND3 Polyclonal Antibody | anti-KCND3 antibody

KCND3 antibody - middle region

Gene Names
KCND3; KV4.3; SCA19; SCA22; BRGDA9; KCND3L; KCND3S; KSHIVB
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
KCND3; Polyclonal Antibody; KCND3 antibody - middle region; anti-KCND3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KARLARIRVAKTGSSNAYLHSKRNGLLNEALELTGTPEEEHMGKTTSLIE
Sequence Length
636
Applicable Applications for anti-KCND3 antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 92%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human KCND3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RatTarget Name: KCND3Sample Tissue: Rat LiverAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RatTarget Name: KCND3Sample Tissue: Rat LiverAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-KCND3 Antibody Titration: 1.25ug/mlELISA Titer: 1:12500Positive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-KCND3 Antibody Titration: 1.25ug/mlELISA Titer: 1:12500Positive Control: HepG2 cell lysate)
Related Product Information for anti-KCND3 antibody
This is a rabbit polyclonal antibody against KCND3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). KCND3 encodes a member of the potassium channel, voltage-gated, shal-related subfamily, members of which form voltage-activated A-type potassium ion channels and are prominent in the repolarization phase of the action potential.
Product Categories/Family for anti-KCND3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
70kDa
NCBI Official Full Name
potassium voltage-gated channel subfamily D member 3 isoform 2
NCBI Official Synonym Full Names
potassium voltage-gated channel subfamily D member 3
NCBI Official Symbol
KCND3
NCBI Official Synonym Symbols
KV4.3; SCA19; SCA22; BRGDA9; KCND3L; KCND3S; KSHIVB
NCBI Protein Information
potassium voltage-gated channel subfamily D member 3
UniProt Protein Name
Potassium voltage-gated channel subfamily D member 3
UniProt Gene Name
KCND3
UniProt Entry Name
KCND3_HUMAN

NCBI Description

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shal-related subfamily, members of which form voltage-activated A-type potassium ion channels and are prominent in the repolarization phase of the action potential. This member includes two isoforms with different sizes, which are encoded by alternatively spliced transcript variants of this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

Kv4.3: Pore-forming (alpha) subunit of voltage-gated rapidly inactivating A-type potassium channels. May contribute to I(To) current in heart and I(Sa) current in neurons. Channel properties are modulated by interactions with other alpha subunits and with regulatory subunits. KCND3 rare variants may confer risk for lethal ventricular arrhytmias and be associated with autopsy-negative sudden unexplained death syndrome (SUDS). Belongs to the potassium channel family. D (Shal) (TC 1.A.1.2) subfamily. Kv4.3/KCND3 sub-subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Channel, potassium; Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1p13.3

Cellular Component: voltage-gated potassium channel complex; cell soma; dendrite; plasma membrane; sarcolemma

Molecular Function: protein binding; metal ion binding; delayed rectifier potassium channel activity; A-type (transient outward) potassium channel activity

Biological Process: synaptic transmission; protein homooligomerization; potassium ion transport

Disease: Brugada Syndrome 9; Spinocerebellar Ataxia 19

Research Articles on KCND3

Similar Products

Product Notes

The KCND3 kcnd3 (Catalog #AAA3202456) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KCND3 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KCND3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KCND3 kcnd3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KARLARIRVA KTGSSNAYLH SKRNGLLNEA LELTGTPEEE HMGKTTSLIE. It is sometimes possible for the material contained within the vial of "KCND3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.