Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-KAT5 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit KAT5 Polyclonal Antibody | anti-KAT5 antibody

KAT5 antibody - C-terminal region

Gene Names
KAT5; TIP; ESA1; PLIP; TIP60; cPLA2; HTATIP; ZC2HC5; HTATIP1
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
KAT5; Polyclonal Antibody; KAT5 antibody - C-terminal region; anti-KAT5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LQYLNLINYYKGQYILTLSEDIVDGHERAMLKRLLRIDSKCLHFTPKDWS
Sequence Length
461
Applicable Applications for anti-KAT5 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-KAT5 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-KAT5 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC)

(Rabbit Anti-KAT5 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Testis TissueObserved Staining: Cytoplasm in Leydig cellsPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-KAT5 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Testis TissueObserved Staining: Cytoplasm in Leydig cellsPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(WB Suggested Anti-KAT5 AntibodyPositive Control: Lane 1: 50ug human RKO lysatePrimary Antibody Dilution : 1:500Secondary Antibody : Goat anti-rabbit-Alexa Fluor 680Secondry Antibody Dilution : 1:5000Submitted by: Dr. Syed Morshed)

Western Blot (WB) (WB Suggested Anti-KAT5 AntibodyPositive Control: Lane 1: 50ug human RKO lysatePrimary Antibody Dilution : 1:500Secondary Antibody : Goat anti-rabbit-Alexa Fluor 680Secondry Antibody Dilution : 1:5000Submitted by: Dr. Syed Morshed)

Western Blot (WB)

(WB Suggested Anti-KAT5 AntibodyTitration: 1.0 ug/mlPositive Control: HT1080 Whole CellThere is BioGPS gene expression data showing that KAT5 is expressed in HT1080)

Western Blot (WB) (WB Suggested Anti-KAT5 AntibodyTitration: 1.0 ug/mlPositive Control: HT1080 Whole CellThere is BioGPS gene expression data showing that KAT5 is expressed in HT1080)
Related Product Information for anti-KAT5 antibody
This is a rabbit polyclonal antibody against KAT5. It was validated on Western Blot

Target Description: The protein encoded by this gene belongs to the MYST family of histone acetyl transferases (HATs) and was originally isolated as an HIV-1 TAT-interactive protein. HATs play important roles in regulating chromatin remodeling, transcription and other nuclear processes by acetylating histone and nonhistone proteins. This protein is a histone acetylase that has a role in DNA repair and apoptosis and is thought to play an important role in signal transduction.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
histone acetyltransferase KAT5 isoform 3
NCBI Official Synonym Full Names
lysine acetyltransferase 5
NCBI Official Symbol
KAT5
NCBI Official Synonym Symbols
TIP; ESA1; PLIP; TIP60; cPLA2; HTATIP; ZC2HC5; HTATIP1
NCBI Protein Information
histone acetyltransferase KAT5
UniProt Protein Name
Histone acetyltransferase KAT5
Protein Family
UniProt Gene Name
KAT5
UniProt Synonym Gene Names
HTATIP; TIP60; Tip60
UniProt Entry Name
KAT5_HUMAN

NCBI Description

The protein encoded by this gene belongs to the MYST family of histone acetyl transferases (HATs) and was originally isolated as an HIV-1 TAT-interactive protein. HATs play important roles in regulating chromatin remodeling, transcription and other nuclear processes by acetylating histone and nonhistone proteins. This protein is a histone acetylase that has a role in DNA repair and apoptosis and is thought to play an important role in signal transduction. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jul 2008]

Uniprot Description

Tip60: a histone acetyl transferase (HAT) of the MYST family. Originally isolated as an HIV-1 TAT-interactive protein. Plays an important role in regulating chromatin remodeling, transcription and other nuclear processes by acetylating nuclear proteins. Plays a role in DNA repair and apoptosis. Three splice variants have been described.

Protein type: Nucleolus; Nuclear receptor co-regulator; EC 2.3.1.48; Acetyltransferase

Chromosomal Location of Human Ortholog: 11q13

Cellular Component: nucleoplasm; transcription factor complex; NuA4 histone acetyltransferase complex; perinuclear region of cytoplasm; nucleolus; cytosol; nucleus

Molecular Function: protein binding; histone acetyltransferase activity; androgen receptor binding; metal ion binding; transcription coactivator activity; protein complex binding

Biological Process: proteasomal ubiquitin-dependent protein catabolic process; establishment and/or maintenance of chromatin architecture; transcription, DNA-dependent; viral reproduction; positive regulation of transcription, DNA-dependent; negative regulation of transcription from RNA polymerase II promoter; negative regulation of interleukin-2 production; DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator; double-strand break repair; regulation of growth; androgen receptor signaling pathway; positive regulation of transcription from RNA polymerase II promoter; response to ionizing radiation; histone acetylation; negative regulation of transcription, DNA-dependent

Research Articles on KAT5

Similar Products

Product Notes

The KAT5 kat5 (Catalog #AAA3204278) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KAT5 antibody - C-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's KAT5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). Researchers should empirically determine the suitability of the KAT5 kat5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LQYLNLINYY KGQYILTLSE DIVDGHERAM LKRLLRIDSK CLHFTPKDWS. It is sometimes possible for the material contained within the vial of "KAT5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.