Rabbit anti-Human, Mouse ITM2B Polyclonal Antibody | anti-ITM2B antibody

ITM2B (Integral Membrane Protein 2B, Protein E25B, Transmembrane Protein BRI, BRI, BRI2) APC

Cat. Num. AAA6383312

• Gene Names: ITM2B; BRI; FBD; ABRI; BRI2; E25B; E3-16; RDGCA; imBRI2; BRICD2B
• Reactivity: Human, Mouse
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ITM2B; Polyclonal Antibody; ITM2B (Integral Membrane Protein 2B; Protein E25B; Transmembrane Protein BRI; BRI; BRI2) APC; anti-ITM2B antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human ITM2B. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 1640

• Applicable Applications for anti-ITM2B antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human ITM2B, aa1-266 (NP_068839.1).
• Immunogen Sequence: MVKVTFNSALAQKETKKDEPKSGEEALIIPPDAVAVDCKDPDDVVPVGQRRAWCWCMCFGLAFMLAGVILGGAYLYKYFALQPDDVYYCGIKYIKDDVILNEPSADAPAALYQTIEENIKIFEEEEVEFISVPVPEFADSDPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPRNLLELLINIKAGTYLPQSYLIHEHMVITDRIENIDHLGFFIYRLCHDKETYKLQRRETIKGIQKREASNCFAIRHFENKFAVETLICS
• Conjugate: APC
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(ITM2B rabbit polyclonal antibody. Western Blot analysis of ITM2B expression in mouse liver.)

Western Blot (WB)

(Western Blot analysis of ITM2B expression in transfected 293T cell line by ITM2B polyclonal antibody. Lane 1: ITM2B transfected lysate (29.26kD). Lane 2: Non-transfected lysate. )

Related Product Information for anti-ITM2B antibody

Functions as a protease inhibitor. Plays a role in APP processing regulating the physiological production of the beta amyloid peptide. Restricts docking of gamma-secretase to APP and access of alpha-and beta-secretase to their cleavage APP sequence.

Product Categories/Family for anti-ITM2B antibody

Antibodies; Membrane Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 16740549
• NCBI GeneID: 9445
• NCBI Official Full Name: Homo sapiens integral membrane protein 2B, mRNA
• NCBI Official Synonym Full Names: integral membrane protein 2B
• NCBI Official Symbol: ITM2B
• NCBI Official Synonym Symbols: BRI; FBD; ABRI; BRI2; E25B; E3-16; RDGCA; imBRI2; BRICD2B
• NCBI Protein Information: integral membrane protein 2B
• Protein Family: Integral membrane protein

NCBI Description

Amyloid precursor proteins are processed by beta-secretase and gamma-secretase to produce beta-amyloid peptides which form the characteristic plaques of Alzheimer disease. This gene encodes a transmembrane protein which is processed at the C-terminus by furin or furin-like proteases to produce a small secreted peptide which inhibits the deposition of beta-amyloid. Mutations which result in extension of the C-terminal end of the encoded protein, thereby increasing the size of the secreted peptide, are associated with two neurogenerative diseases, familial British dementia and familial Danish dementia. [provided by RefSeq, Oct 2009]