Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (ITM2B rabbit polyclonal antibody. Western Blot analysis of ITM2B expression in mouse liver.)

Rabbit anti-Human, Mouse ITM2B Polyclonal Antibody | anti-ITM2B antibody

ITM2B (Integral Membrane Protein 2B, Protein E25B, Transmembrane Protein BRI, BRI, BRI2) (PE)

Gene Names
ITM2B; BRI; FBD; ABRI; BRI2; E25B; E3-16; RDGCA; imBRI2; BRICD2B
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ITM2B; Polyclonal Antibody; ITM2B (Integral Membrane Protein 2B; Protein E25B; Transmembrane Protein BRI; BRI; BRI2) (PE); anti-ITM2B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ITM2B. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
1640
Applicable Applications for anti-ITM2B antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human ITM2B, aa1-266 (NP_068839.1).
Immunogen Sequence
MVKVTFNSALAQKETKKDEPKSGEEALIIPPDAVAVDCKDPDDVVPVGQRRAWCWCMCFGLAFMLAGVILGGAYLYKYFALQPDDVYYCGIKYIKDDVILNEPSADAPAALYQTIEENIKIFEEEEVEFISVPVPEFADSDPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPRNLLELLINIKAGTYLPQSYLIHEHMVITDRIENIDHLGFFIYRLCHDKETYKLQRRETIKGIQKREASNCFAIRHFENKFAVETLICS
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(ITM2B rabbit polyclonal antibody. Western Blot analysis of ITM2B expression in mouse liver.)

Western Blot (WB) (ITM2B rabbit polyclonal antibody. Western Blot analysis of ITM2B expression in mouse liver.)

Western Blot (WB)

(Western Blot analysis of ITM2B expression in transfected 293T cell line by ITM2B polyclonal antibody. Lane 1: ITM2B transfected lysate (29.26kD). Lane 2: Non-transfected lysate. )

Western Blot (WB) (Western Blot analysis of ITM2B expression in transfected 293T cell line by ITM2B polyclonal antibody. Lane 1: ITM2B transfected lysate (29.26kD). Lane 2: Non-transfected lysate. )
Related Product Information for anti-ITM2B antibody
Functions as a protease inhibitor. Plays a role in APP processing regulating the physiological production of the beta amyloid peptide. Restricts docking of gamma-secretase to APP and access of alpha-and beta-secretase to their cleavage APP sequence.
Product Categories/Family for anti-ITM2B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens integral membrane protein 2B, mRNA
NCBI Official Synonym Full Names
integral membrane protein 2B
NCBI Official Symbol
ITM2B
NCBI Official Synonym Symbols
BRI; FBD; ABRI; BRI2; E25B; E3-16; RDGCA; imBRI2; BRICD2B
NCBI Protein Information
integral membrane protein 2B
Protein Family

NCBI Description

Amyloid precursor proteins are processed by beta-secretase and gamma-secretase to produce beta-amyloid peptides which form the characteristic plaques of Alzheimer disease. This gene encodes a transmembrane protein which is processed at the C-terminus by furin or furin-like proteases to produce a small secreted peptide which inhibits the deposition of beta-amyloid. Mutations which result in extension of the C-terminal end of the encoded protein, thereby increasing the size of the secreted peptide, are associated with two neurogenerative diseases, familial British dementia and familial Danish dementia. [provided by RefSeq, Oct 2009]

Research Articles on ITM2B

Similar Products

Product Notes

The ITM2B (Catalog #AAA6383321) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ITM2B (Integral Membrane Protein 2B, Protein E25B, Transmembrane Protein BRI, BRI, BRI2) (PE) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ITM2B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ITM2B for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ITM2B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.