Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (ITGB3 antibody - N-terminal region validated by WB using Placenta Lysate at 1 ug/ml.)

Rabbit ITGB3 Polyclonal Antibody | anti-ITGB3 antibody

ITGB3 antibody - N-terminal region

Gene Names
ITGB3; GT; CD61; GP3A; BDPLT2; GPIIIa; BDPLT16
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ITGB3; Polyclonal Antibody; ITGB3 antibody - N-terminal region; anti-ITGB3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVT
Sequence Length
788
Applicable Applications for anti-ITGB3 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Rabbit: 93%; Rat: 92%; Sheep: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(ITGB3 antibody - N-terminal region validated by WB using Placenta Lysate at 1 ug/ml.)

Western Blot (WB) (ITGB3 antibody - N-terminal region validated by WB using Placenta Lysate at 1 ug/ml.)

Western Blot (WB)

(Sample type: human aveolar basal endothelial cells (25ug)Primary Dilution: 1:1000Secondary Antibody: Goat anti-Rabbit-HRPSecondary Dilution: 1:5000Image Submitted by: Andreas Eisenreich Charite Universitatsmedizin Berlin)

Western Blot (WB) (Sample type: human aveolar basal endothelial cells (25ug)Primary Dilution: 1:1000Secondary Antibody: Goat anti-Rabbit-HRPSecondary Dilution: 1:5000Image Submitted by: Andreas Eisenreich Charite Universitatsmedizin Berlin)

Western Blot (WB)

(Sample type: human microvascular endothelial cells (25ug)Primary Dilution: 1:1000Secondary Antibody: Goat anti-Rabbit-HRPSecondary Dilution: 1:5000Image Submitted by: Andreas Eisenreich Charite Universitatsmedizin Berlin)

Western Blot (WB) (Sample type: human microvascular endothelial cells (25ug)Primary Dilution: 1:1000Secondary Antibody: Goat anti-Rabbit-HRPSecondary Dilution: 1:5000Image Submitted by: Andreas Eisenreich Charite Universitatsmedizin Berlin)
Related Product Information for anti-ITGB3 antibody
This is a rabbit polyclonal antibody against ITGB3. It was validated on Western Blot

Target Description: The ITGB3 protein product is the integrin beta chain beta 3. Integrins are integral cell-surface proteins composed of an alpha chain and a beta chain. A given chain may combine with multiple partners resulting in different integrins. Integrin beta 3 is found along with the alpha IIb chain in platelets. Integrins are known to participate in cell adhesion as well as cell-surface mediated signalling.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
84kDa
NCBI Official Full Name
integrin beta-3
NCBI Official Synonym Full Names
integrin subunit beta 3
NCBI Official Symbol
ITGB3
NCBI Official Synonym Symbols
GT; CD61; GP3A; BDPLT2; GPIIIa; BDPLT16
NCBI Protein Information
integrin beta-3
UniProt Protein Name
Integrin beta-3
Protein Family
UniProt Gene Name
ITGB3
UniProt Synonym Gene Names
GP3A; GPIIIa
UniProt Entry Name
ITB3_HUMAN

NCBI Description

The ITGB3 protein product is the integrin beta chain beta 3. Integrins are integral cell-surface proteins composed of an alpha chain and a beta chain. A given chain may combine with multiple partners resulting in different integrins. Integrin beta 3 is found along with the alpha IIb chain in platelets. Integrins are known to participate in cell adhesion as well as cell-surface mediated signalling. [provided by RefSeq, Jul 2008]

Uniprot Description

ITGB3: integrin alpha-V/beta-3 is a receptor for cytotactin, fibronectin, laminin, matrix metalloproteinase-2, osteopontin, osteomodulin, prothrombin, thrombospondin, vitronectin and von Willebrand factor. Integrin alpha-IIB/beta-3 is a receptor for fibronectin, fibrinogen, plasminogen, prothrombin, thrombospondin and vitronectin. Integrins alpha-IIB/beta-3 and alpha-V/beta-3 recognize the sequence R-G-D in a wide array of ligands. Integrin alpha-IIB/beta-3 recognizes the sequence H-H-L-G-G-G-A-K-Q-A-G-D-V in fibrinogen gamma chain. Following activation integrin alpha- IIB/beta-3 brings about platelet/platelet interaction through binding of soluble fibrinogen. This step leads to rapid platelet aggregation which physically plugs ruptured endothelial surface.

Protein type: Membrane protein, integral; Motility/polarity/chemotaxis; Cell adhesion

Chromosomal Location of Human Ortholog: 17q21.32

Cellular Component: filopodium membrane; platelet alpha granule membrane; focal adhesion; cell surface; microvillus membrane; integral to plasma membrane; plasma membrane; melanosome; integrin complex; nucleus; receptor complex

Molecular Function: identical protein binding; protein binding; protease binding; extracellular matrix binding; vascular endothelial growth factor receptor 2 binding; fibronectin binding; platelet-derived growth factor receptor binding; protein disulfide isomerase activity; cell adhesion molecule binding; receptor activity

Biological Process: negative regulation of lipid transport; axon guidance; entry of virus into host cell; extracellular matrix organization and biogenesis; protein folding; wound healing; cell-matrix adhesion; smooth muscle cell migration; mesodermal cell differentiation; negative chemotaxis; positive regulation of vascular endothelial growth factor receptor signaling pathway; platelet degranulation; cell-substrate junction assembly; cell growth; cell adhesion; integrin-mediated signaling pathway; platelet activation; regulation of bone resorption; cell migration; negative regulation of lipoprotein metabolic process; angiogenesis involved in wound healing; cell-substrate adhesion; heterotypic cell-cell adhesion; positive regulation of peptidyl-tyrosine phosphorylation; negative regulation of low-density lipoprotein receptor biosynthetic process; activation of protein kinase activity; positive regulation of endothelial cell proliferation; positive regulation of protein amino acid phosphorylation; tube development; blood coagulation; vascular endothelial growth factor receptor signaling pathway; leukocyte migration

Disease: Myocardial Infarction, Susceptibility To; Glanzmann Thrombasthenia; Bleeding Disorder, Platelet-type, 16

Research Articles on ITGB3

Similar Products

Product Notes

The ITGB3 itgb3 (Catalog #AAA3216099) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ITGB3 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's ITGB3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ITGB3 itgb3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PLGSPRCDLK ENLLKDNCAP ESIEFPVSEA RVLEDRPLSD KGSGDSSQVT. It is sometimes possible for the material contained within the vial of "ITGB3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.