Western Blot (WB)
(ISLR2 antibody (MBS5301123) used at 1 ug/ml to detect target protein.)
Rabbit ISLR2 Polyclonal Antibody | anti-ISLR2 antibody
ISLR2 antibody
Gene Names
ISLR2; LINX
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
ISLR2; Polyclonal Antibody; ISLR2 antibody; Polyclonal ISLR2; Anti-ISLR2; ISLR-2; KIAA1465; ISLR 2; Immunoglobulin Superfamily Containing Leucine-Rich Repeat 2; anti-ISLR2 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
ISLR2 antibody was raised against the N terminal of ISLR2
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ISLR2 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
334
Applicable Applications for anti-ISLR2 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
ISLR2 is a single-pass membrane protein. It contains 1 Ig-like (immunoglobulin-like) domain and 5 LRR (leucine-rich) repeats. The exact function of ISLR2 remains unknown.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
ISLR2 antibody was raised using the N terminal of ISLR2 corresponding to a region with amino acids PFHCGCGLVWLQAWAASTRVSLPEPDSIACASPPALQGVPVYRLPALPCA
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(ISLR2 antibody (MBS5301123) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(ISLR2 antibody (MBS5301123) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-ISLR2 antibody
Rabbit polyclonal ISLR2 antibody raised against the N terminal of ISLR2
Product Categories/Family for anti-ISLR2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
79 kDa (MW of target protein)
NCBI Official Full Name
ISLR2 protein
NCBI Official Synonym Full Names
immunoglobulin superfamily containing leucine-rich repeat 2
NCBI Official Symbol
ISLR2
NCBI Official Synonym Symbols
LINX
NCBI Protein Information
immunoglobulin superfamily containing leucine-rich repeat protein 2
UniProt Protein Name
Immunoglobulin superfamily containing leucine-rich repeat protein 2
UniProt Gene Name
ISLR2
UniProt Synonym Gene Names
KIAA1465; LINX
UniProt Entry Name
ISLR2_HUMAN
Uniprot Description
ISLR2: Required for axon extension during neural development.
Protein type: Membrane protein, integral; Cell development/differentiation; Immunoglobulin superfamily; Cell surface
Chromosomal Location of Human Ortholog: 15q24.1
Cellular Component: cell surface; plasma membrane; integral to membrane
Biological Process: positive regulation of axon extension
Similar Products
Product Notes
The ISLR2 islr2 (Catalog #AAA5301123) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ISLR2 antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ISLR2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the ISLR2 islr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ISLR2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
