Western Blot (WB)
(LRRC17 antibody (MBS839697) used at 0.5 ug/ml to detect target protein.)
Rabbit LRRC17 Polyclonal Antibody | anti-LRRC17 antibody
LRRC17 antibody
Gene Names
LRRC17; P37NB
Applications
Western Blot
Purity
Affinity purified
Synonyms
LRRC17; Polyclonal Antibody; LRRC17 antibody; Polyclonal LRRC17; Anti-LRRC17; LRRC-17; LRRC 17; Leucine Rich Repeat Containing 17; P37NB; anti-LRRC17 antibody
Host
Rabbit
Clonality
Polyclonal
Specificity
LRRC17 antibody was raised against the middle region of LRRC17
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LRRC17 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
313
Applicable Applications for anti-LRRC17 antibody
Western Blot (WB)
Application Notes
WB: 0.5 ug/ml
Biological Significance
LRRC17 contains 6 LRR (leucine-rich) repeats. The exact function of LRRC17 remains unknown.
Cross-Reactivity
Human
Immunogen
LRRC17 antibody was raised using the middle region of LRRC17 corresponding to a region with amino acids YVFPIQTLDCKRKELKKVPNNIPPDIVKLDLSYNKINQLRPKEFEDVHEL
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(LRRC17 antibody (MBS839697) used at 0.5 ug/ml to detect target protein.)
Western Blot (WB)
(LRRC17 antibody (MBS839697) used at 0.5 ug/ml to detect target protein.)
Related Product Information for anti-LRRC17 antibody
Rabbit polyclonal LRRC17 antibody raised against the middle region of LRRC17
Product Categories/Family for anti-LRRC17 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
52 kDa (MW of target protein)
NCBI Official Full Name
leucine-rich repeat-containing protein 17 isoform 2
NCBI Official Synonym Full Names
leucine rich repeat containing 17
NCBI Official Symbol
LRRC17
NCBI Official Synonym Symbols
P37NB
NCBI Protein Information
leucine-rich repeat-containing protein 17
UniProt Protein Name
Leucine-rich repeat-containing protein 17
Protein Family
UniProt Gene Name
LRRC17
UniProt Synonym Gene Names
P37NB
UniProt Entry Name
LRC17_HUMAN
Uniprot Description
LRRC17: Involved in bone homeostasis. Acts as a negative regulator of RANKL-induced osteoclast precursor differentiation from bone marrow precursors. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Secreted; Secreted, signal peptide
Chromosomal Location of Human Ortholog: 7q22.1
Cellular Component: extracellular space
Biological Process: bone marrow development; osteoblast differentiation; negative regulation of osteoclast differentiation; osteoblast proliferation
Similar Products
Product Notes
The LRRC17 lrrc17 (Catalog #AAA839697) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's LRRC17 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 0.5 ug/ml. Researchers should empirically determine the suitability of the LRRC17 lrrc17 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LRRC17, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
