Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Researcher: Dr. Yuzhi Chen, University of Arkansas for Medical ScienceApplication: IHCSpecies+tissue/cell type: Mouse brain stem cellsPrimary antibody dilution: 1:500Secondary antibody: Goat anti-rabbit Alexa-Fluor 594Secondary antibody dilution: 1:1000)

Rabbit ISG15 Polyclonal Antibody | anti-ISG15 antibody

ISG15 antibody - middle region

Gene Names
ISG15; G1P2; IP17; UCRP; IFI15; IMD38; hUCRP
Reactivity
Tested Reactivity: Human, Mouse Predicted Reactivity: Cow, Dog, Goat, Horse, Human, Pig, Rabbit, Sheep
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
ISG15; Polyclonal Antibody; ISG15 antibody - middle region; anti-ISG15 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Tested Reactivity: Human, Mouse Predicted Reactivity: Cow, Dog, Goat, Horse, Human, Pig, Rabbit, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGK
Sequence Length
165
Applicable Applications for anti-ISG15 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Protein Size (# AA)
165 amino acids
Protein Interactions
GPI; EPRS; ENO1; EEF2; EEF1A1; ANXA2; ACTB; ACLY; AARS; CAND1; USP18; UBA7; UBA1; UBC; TARS; STAT1; PKM; AIFM1; MDH1; LDHA; HSP90AB1; HSP90AA1; HSPA8; VCP; PCNA; BAG3; ZNF318; UGP2; UBE2N; DSTN; PRDX6; CTNNB1; CFL1; GAPDH; HERC5; PRDX1; IRF3; HSPB1; UBE2E
Homology
Cow: 86%; Dog: 86%; Goat: 86%; Horse: 86%; Human: 100%; Pig: 79%; Rabbit: 79%; Sheep: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ISG15
Blocking Peptide
For anti-ISG15 (MBS3214314) antibody is Catalog # MBS3239251
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Researcher: Dr. Yuzhi Chen, University of Arkansas for Medical ScienceApplication: IHCSpecies+tissue/cell type: Mouse brain stem cellsPrimary antibody dilution: 1:500Secondary antibody: Goat anti-rabbit Alexa-Fluor 594Secondary antibody dilution: 1:1000)

Immunohistochemistry (IHC) (Researcher: Dr. Yuzhi Chen, University of Arkansas for Medical ScienceApplication: IHCSpecies+tissue/cell type: Mouse brain stem cellsPrimary antibody dilution: 1:500Secondary antibody: Goat anti-rabbit Alexa-Fluor 594Secondary antibody dilution: 1:1000)

Western Blot (WB)

(Sample Type: Human NT-2, mouse brainSample Type: 1. Human NT-2 cells (60ug) 2. mouse brain extracts (80ug) Primary Antibody Dilution:2ug/ml Secondary Antibody: IRDye 800CW goat anti-rabbit from Li-COR Bioscience Secondary Antibody Dilution:1: 20,000 Image Submitted by: Yuzhi Chen University of Arkansas for Medical Science)

Western Blot (WB) (Sample Type: Human NT-2, mouse brainSample Type: 1. Human NT-2 cells (60ug) 2. mouse brain extracts (80ug) Primary Antibody Dilution:2ug/ml Secondary Antibody: IRDye 800CW goat anti-rabbit from Li-COR Bioscience Secondary Antibody Dilution:1: 20,000 Image Submitted by: Yuzhi Chen University of Arkansas for Medical Science)

Western Blot (WB)

(Host: RabbitTarget Name: ISG15Sample Type: Human 293TAntibody Dilution: 1.0ug/mlISG15 is supported by BioGPS gene expression data to be expressed in HEK293T)

Western Blot (WB) (Host: RabbitTarget Name: ISG15Sample Type: Human 293TAntibody Dilution: 1.0ug/mlISG15 is supported by BioGPS gene expression data to be expressed in HEK293T)

Western Blot (WB)

(Host: RabbitTarget Name: ISG15Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ISG15Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: ISG15Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ISG15Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: ISG15Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ISG15Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: ISG15Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ISG15Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: ISG15Sample Type: Human HelaAntibody Dilution: 1.0ug/mlISG15 is supported by BioGPS gene expression data to be expressed in HeLa)

Western Blot (WB) (Host: RabbitTarget Name: ISG15Sample Type: Human HelaAntibody Dilution: 1.0ug/mlISG15 is supported by BioGPS gene expression data to be expressed in HeLa)

Western Blot (WB)

(Host: RabbitTarget Name: ISG15Sample Type: Human MCF7Antibody Dilution: 1.0ug/mlISG15 is supported by BioGPS gene expression data to be expressed in MCF7)

Western Blot (WB) (Host: RabbitTarget Name: ISG15Sample Type: Human MCF7Antibody Dilution: 1.0ug/mlISG15 is supported by BioGPS gene expression data to be expressed in MCF7)

Western Blot (WB)

(WB Suggested Anti-ISG15 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human kidney)

Western Blot (WB) (WB Suggested Anti-ISG15 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human kidney)
Related Product Information for anti-ISG15 antibody
This is a rabbit polyclonal antibody against ISG15. It was validated on Western Blot

Target Description: ISG15 is a ubiquitin-like protein that becomes conjugated to many cellular proteins upon activation by interferon-alpha.
Product Categories/Family for anti-ISG15 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17kDa
NCBI Official Full Name
ubiquitin-like protein ISG15
NCBI Official Synonym Full Names
ISG15 ubiquitin like modifier
NCBI Official Symbol
ISG15
NCBI Official Synonym Symbols
G1P2; IP17; UCRP; IFI15; IMD38; hUCRP
NCBI Protein Information
ubiquitin-like protein ISG15
UniProt Protein Name
Ubiquitin-like protein ISG15
Protein Family
UniProt Gene Name
ISG15
UniProt Synonym Gene Names
G1P2; UCRP; IP17; hUCRP
UniProt Entry Name
ISG15_HUMAN

NCBI Description

The protein encoded by this gene is a ubiquitin-like protein that is conjugated to intracellular target proteins upon activation by interferon-alpha and interferon-beta. Several functions have been ascribed to the encoded protein, including chemotactic activity towards neutrophils, direction of ligated target proteins to intermediate filaments, cell-to-cell signaling, and antiviral activity during viral infections. While conjugates of this protein have been found to be noncovalently attached to intermediate filaments, this protein is sometimes secreted. [provided by RefSeq, Dec 2012]

Uniprot Description

ISG15: Ubiquitin-like protein that is conjugated to intracellular target proteins after IFN-alpha or IFN-beta stimulation. Its enzymatic pathway is partially distinct from that of ubiquitin, differing in substrate specificity and interaction with ligating enzymes. ISG15 conjugation pathway uses a dedicated E1 enzyme, but seems to converge with the Ub conjugation pathway at the level of a specific E2 enzyme. Targets include STAT1, SERPINA3G/SPI2A, JAK1, MAPK3/ERK1, PLCG1, EIF2AK2/PKR, MX1/MxA, and RIG-1. Deconjugated by USP18/UBP43. Shows specific chemotactic activity towards neutrophils and activates them to induce release of eosinophil chemotactic factors. May serve as a trans-acting binding factor directing the association of ligated target proteins to intermediate filaments. May also be involved in autocrine, paracrine and endocrine mechanisms, as in cell-to-cell signaling, possibly partly by inducing IFN-gamma secretion by monocytes and macrophages. Seems to display antiviral activity during viral infections. Interacts with, and is conjugated to its targets by the UBE1L (E1 enzyme) and UBE2E2 (E2 enzyme) (Probable). Interaction with influenza B NS1 protein inhibits this conjugation. By type I interferons. Detected in lymphoid cells, striated and smooth muscle, several epithelia and neurons.

Protein type: Ubiquitin-like modifier

Chromosomal Location of Human Ortholog: 1p36.33

Cellular Component: extracellular region; cytosol

Molecular Function: protein tag; protein binding

Biological Process: modification-dependent protein catabolic process; ISG15-protein conjugation; viral reproduction; negative regulation of viral genome replication; regulation of interferon-gamma production; cytokine and chemokine mediated signaling pathway; positive regulation of erythrocyte differentiation; defense response to bacterium; innate immune response; negative regulation of protein ubiquitination; defense response to virus; negative regulation of interferon type I production

Disease: Immunodeficiency 38

Research Articles on ISG15

Similar Products

Product Notes

The ISG15 isg15 (Catalog #AAA3214314) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ISG15 antibody - middle region reacts with Tested Reactivity: Human, Mouse Predicted Reactivity: Cow, Dog, Goat, Horse, Human, Pig, Rabbit, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's ISG15 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the ISG15 isg15 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EPLSILVRNN KGRSSTYEVR LTQTVAHLKQ QVSGLEGVQD DLFWLTFEGK. It is sometimes possible for the material contained within the vial of "ISG15, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.