Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human ISG15 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 16 kDa.)

ISG15 recombinant protein

Recombinant Human ISG15 Protein

Gene Names
ISG15; G1P2; IP17; UCRP; IFI15; IMD38; hUCRP
Purity
>97% by SDS-PAGE.
Synonyms
ISG15; Recombinant Human ISG15 Protein; G1P2; hUCRP; IFI15; IMD38; IP17; UCRP; ISG15 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
>97% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of 50mM HEPES, 100mM NaCl, pH 7.5.
Sequence
GWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGG
Sequence Length
165
Species
Human
Endotoxin
< 1.0 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
No tag
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human ISG15 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 16 kDa.)

SDS-Page (Recombinant Human ISG15 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 16 kDa.)
Related Product Information for ISG15 recombinant protein
Description: Recombinant Human ISG15 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Gly2-Gly157) of human ISG15 (Accession #NP_005092.1).

Background: The protein is a ubiquitin-like protein that is conjugated to intracellular target proteins upon activation by interferon-alpha and interferon-beta. Several functions have been ascribed to the encoded protein, including chemotactic activity towards neutrophils, direction of ligated target proteins to intermediate filaments, cell-to-cell signaling, and antiviral activity during viral infections. While conjugates of this protein have been found to be noncovalently attached to intermediate filaments, this protein is sometimes secreted.
Product Categories/Family for ISG15 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
ubiquitin-like protein ISG15
NCBI Official Synonym Full Names
ISG15 ubiquitin like modifier
NCBI Official Symbol
ISG15
NCBI Official Synonym Symbols
G1P2; IP17; UCRP; IFI15; IMD38; hUCRP
NCBI Protein Information
ubiquitin-like protein ISG15
UniProt Protein Name
Ubiquitin-like protein ISG15
Protein Family
UniProt Gene Name
ISG15
UniProt Synonym Gene Names
G1P2; UCRP; IP17; hUCRP
UniProt Entry Name
ISG15_HUMAN

NCBI Description

The protein encoded by this gene is a ubiquitin-like protein that is conjugated to intracellular target proteins upon activation by interferon-alpha and interferon-beta. Several functions have been ascribed to the encoded protein, including chemotactic activity towards neutrophils, direction of ligated target proteins to intermediate filaments, cell-to-cell signaling, and antiviral activity during viral infections. While conjugates of this protein have been found to be noncovalently attached to intermediate filaments, this protein is sometimes secreted. [provided by RefSeq, Dec 2012]

Uniprot Description

ISG15: Ubiquitin-like protein that is conjugated to intracellular target proteins after IFN-alpha or IFN-beta stimulation. Its enzymatic pathway is partially distinct from that of ubiquitin, differing in substrate specificity and interaction with ligating enzymes. ISG15 conjugation pathway uses a dedicated E1 enzyme, but seems to converge with the Ub conjugation pathway at the level of a specific E2 enzyme. Targets include STAT1, SERPINA3G/SPI2A, JAK1, MAPK3/ERK1, PLCG1, EIF2AK2/PKR, MX1/MxA, and RIG-1. Deconjugated by USP18/UBP43. Shows specific chemotactic activity towards neutrophils and activates them to induce release of eosinophil chemotactic factors. May serve as a trans-acting binding factor directing the association of ligated target proteins to intermediate filaments. May also be involved in autocrine, paracrine and endocrine mechanisms, as in cell-to-cell signaling, possibly partly by inducing IFN-gamma secretion by monocytes and macrophages. Seems to display antiviral activity during viral infections. Interacts with, and is conjugated to its targets by the UBE1L (E1 enzyme) and UBE2E2 (E2 enzyme) (Probable). Interaction with influenza B NS1 protein inhibits this conjugation. By type I interferons. Detected in lymphoid cells, striated and smooth muscle, several epithelia and neurons.

Protein type: Ubiquitin-like modifier

Chromosomal Location of Human Ortholog: 1p36.33

Cellular Component: extracellular region; cytosol

Molecular Function: protein tag; protein binding

Biological Process: modification-dependent protein catabolic process; ISG15-protein conjugation; viral reproduction; negative regulation of viral genome replication; regulation of interferon-gamma production; cytokine and chemokine mediated signaling pathway; positive regulation of erythrocyte differentiation; defense response to bacterium; innate immune response; negative regulation of protein ubiquitination; defense response to virus; negative regulation of interferon type I production

Disease: Immunodeficiency 38

Research Articles on ISG15

Similar Products

Product Notes

The ISG15 isg15 (Catalog #AAA9139664) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: GWDLTVKMLA GNEFQVSLSS SMSVSELKAQ ITQKIGVHAF QQRLAVHPSG VALQDRVPLA SQGLGPGSTV LLVVDKCDEP LSILVRNNKG RSSTYEVRLT QTVAHLKQQV SGLEGVQDDL FWLTFEGKPL EDQLPLGEYG LKPLSTVFMN LRLRGG. It is sometimes possible for the material contained within the vial of "ISG15, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.