Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Dctn1 AntibodyPositive Control: Lane 1: 80ug rat brain extractPrimary Antibody Dilution : 1:500Secondary Antibody : IRDye 800 CW goat anti-rabbit from Li-COR BioscienceSecondry Antibody Dilution : 1:20,000Submitted by: Dr. Yuzhi Chen, University of Arkansas for Medical Science)

Rabbit Dctn1 Polyclonal Antibody | anti-DCTN1 antibody

Dctn1 Antibody - C-terminal region

Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Dctn1; Polyclonal Antibody; Dctn1 Antibody - C-terminal region; anti-DCTN1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EANVRLSLLEKKLDSAAKDADERIEKVQTRLEETQTLLRKKEKEFEETMD
Sequence Length
1280
Applicable Applications for anti-DCTN1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Dctn1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Dctn1 AntibodyPositive Control: Lane 1: 80ug rat brain extractPrimary Antibody Dilution : 1:500Secondary Antibody : IRDye 800 CW goat anti-rabbit from Li-COR BioscienceSecondry Antibody Dilution : 1:20,000Submitted by: Dr. Yuzhi Chen, University of Arkansas for Medical Science)

Western Blot (WB) (WB Suggested Anti-Dctn1 AntibodyPositive Control: Lane 1: 80ug rat brain extractPrimary Antibody Dilution : 1:500Secondary Antibody : IRDye 800 CW goat anti-rabbit from Li-COR BioscienceSecondry Antibody Dilution : 1:20,000Submitted by: Dr. Yuzhi Chen, University of Arkansas for Medical Science)

Western Blot (WB)

(WB Suggested Anti-Dctn1 AntibodyTitration: 1.0 ug/mlPositive Control: Rat Thymus)

Western Blot (WB) (WB Suggested Anti-Dctn1 AntibodyTitration: 1.0 ug/mlPositive Control: Rat Thymus)
Related Product Information for anti-DCTN1 antibody
This is a rabbit polyclonal antibody against Dctn1. It was validated on Western Blot

Target Description: Dctn1 is a component of dynein microtubule activated ATPase, which acts as a microtubule motor.
Product Categories/Family for anti-DCTN1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
140kDa
NCBI Official Full Name
dynactin subunit 1
NCBI Official Synonym Full Names
dynactin subunit 1
NCBI Official Symbol
Dctn1
NCBI Protein Information
dynactin subunit 1
UniProt Protein Name
Dynactin subunit 1
Protein Family
UniProt Gene Name
Dctn1
UniProt Synonym Gene Names
DP-150

NCBI Description

component of dynein microtubule activated ATPase, which acts as a microtubule motor [RGD, Feb 2006]

Uniprot Description

Plays a key role in dynein-mediated retrograde transport of vesicles and organelles along microtubules by recruiting and tethering dynein to microtubules. Binds to both dynein and microtubules providing a link between specific cargos, microtubules and dynein. Essential for targeting dynein to microtubule plus ends, recruiting dynein to membranous cargos and enhancing dynein processivity (the ability to move along a microtubule for a long distance without falling off the track). Can also act as a brake to slow the dynein motor during motility along the microtubule. Can regulate microtubule stability by promoting microtubule formation, nucleation and polymerization and by inhibiting microtubule catastrophe in neurons. Inhibits microtubule catastrophe by binding both to microtubules and to tubulin, leading to enhanced microtubule stability along the axon. Plays a role in metaphase spindle orientation. Plays a role in centriole cohesion and subdistal appendage organization and function. Its recruitement to the centriole in a KIF3A-dependent manner is essential for the maintenance of centriole cohesion and the formation of subdistal appendage. Also required for microtubule anchoring at the mother centriole. Plays a role in primary cilia formation.

Research Articles on DCTN1

Similar Products

Product Notes

The DCTN1 dctn1 (Catalog #AAA3210565) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Dctn1 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Dctn1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DCTN1 dctn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EANVRLSLLE KKLDSAAKDA DERIEKVQTR LEETQTLLRK KEKEFEETMD. It is sometimes possible for the material contained within the vial of "Dctn1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.