<
Western Blot (WB)
(Western Blot detection against Immunogen (41.29kD).)
Mouse anti-Human NFATC2IP Monoclonal Antibody | anti-NFATC2IP antibody
NFATC2IP (Nuclear Factor Of Activated T-Cells, Cytoplasmic, Calcineurin-Dependent 2 Interacting Protein, FLJ14639, MGC126790, MGC138387) (PE)
Gene Names
NFATC2IP; ESC2; NIP45; RAD60
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NFATC2IP; Monoclonal Antibody; NFATC2IP (Nuclear Factor Of Activated T-Cells; Cytoplasmic; Calcineurin-Dependent 2 Interacting Protein; FLJ14639; MGC126790; MGC138387) (PE); anti-NFATC2IP antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2D7-A10
Specificity
Recognizes human NFATC2IP.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-NFATC2IP antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-139 from human NFATC2IP (AAH18311) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSEPLQSVVDHMATHLGVSPSRILLLFGETELSPTATPRTLKLGVADIIDCVVLTSSPEATETSQQLQLRVQG KEKHQTLEVSLSRDSPLKTLMSHYEEAMGLSGRKLSFFFDGTKLSGRELPADLGMESGDLIEVWG
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (41.29kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (41.29kD).)
Western Blot (WB)
(Western Blot analysis of NFATC2IP expression in transfected 293T cell line by NFATC2IP monoclonal antibody Lane 1: NFATC2IP transfected lysate (15kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of NFATC2IP expression in transfected 293T cell line by NFATC2IP monoclonal antibody Lane 1: NFATC2IP transfected lysate (15kD). Lane 2: Non-transfected lysate.)
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to NFATC2IP on HeLa cell. [antibody concentration 10ug/ml].)
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to NFATC2IP on HeLa cell. [antibody concentration 10ug/ml].)
Testing Data
(Detection limit for recombinant GST tagged NFATC2IP is ~0.1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged NFATC2IP is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-NFATC2IP antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
13,831 Da
NCBI Official Full Name
Homo sapiens nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 interacting protein, mRNA
NCBI Official Synonym Full Names
nuclear factor of activated T-cells 2 interacting protein
NCBI Official Symbol
NFATC2IP
NCBI Official Synonym Symbols
ESC2; NIP45; RAD60
NCBI Protein Information
NFATC2-interacting protein
Protein Family
Research Articles on NFATC2IP
Similar Products
Product Notes
The NFATC2IP (Catalog #AAA6159072) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NFATC2IP (Nuclear Factor Of Activated T-Cells, Cytoplasmic, Calcineurin-Dependent 2 Interacting Protein, FLJ14639, MGC126790, MGC138387) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NFATC2IP can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NFATC2IP for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NFATC2IP, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
