Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of IMPA2 expression in transfected 293T cell line by IMPA2 polyclonal antibody. Lane 1: IMPA2 transfected lysate (31.68kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human IMPA2 Polyclonal Antibody | anti-IMPA2 antibody

IMPA2 (Inositol Monophosphatase 2, IMP 2, IMPase 2, Inositol-1(or 4)-monophosphatase 2, Myo-inositol Monophosphatase A2, IMP.18P)

Reactivity
Human
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
IMPA2; Polyclonal Antibody; IMPA2 (Inositol Monophosphatase 2; IMP 2; IMPase 2; Inositol-1(or 4)-monophosphatase 2; Myo-inositol Monophosphatase A2; IMP.18P); Anti -IMPA2 (Inositol Monophosphatase 2; anti-IMPA2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human IMPA2.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MKPSGEDQAALAAGPWEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHLVEDLIISELRERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVRQELEFGVIYHCTEERLYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLHAKAHGVRVIGSSTLALCHLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQALQTINYGRDDEK
Applicable Applications for anti-IMPA2 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
Suitable for use in Western Blot and Immunohistochemistry.
Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Immunogen
Full length human IMPA2, aa1-288 (AAH17176).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of IMPA2 expression in transfected 293T cell line by IMPA2 polyclonal antibody. Lane 1: IMPA2 transfected lysate (31.68kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of IMPA2 expression in transfected 293T cell line by IMPA2 polyclonal antibody. Lane 1: IMPA2 transfected lysate (31.68kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of purified antibody to IMPA2 on formalin-fixed paraffin-embedded human colon cancer. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of purified antibody to IMPA2 on formalin-fixed paraffin-embedded human colon cancer. [antibody concentration 3ug/ml])
Related Product Information for anti-IMPA2 antibody
Can use myo-inositol monophosphates, scylloinositol 1,4-diphosphate, glucose-1-phosphate, beta-glycerophosphate, and 2'-AMP as substrates. Has been implicated as the pharmacological target for lithium Li+ action in brain.
Product Categories/Family for anti-IMPA2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31,321 Da
NCBI Official Full Name
inositol monophosphatase 2
NCBI Official Synonym Full Names
inositol(myo)-1(or 4)-monophosphatase 2
NCBI Official Symbol
IMPA2
NCBI Protein Information
inositol monophosphatase 2; IMP 2; IMPase 2; inosine monophosphatase 2; myo-inositol monophosphatase A2; inositol monophosphatase 2 variant 1; inositol monophosphatase 2 variant 2
UniProt Protein Name
Inositol monophosphatase 2
UniProt Gene Name
IMPA2
UniProt Synonym Gene Names
IMP.18P; IMP 2; IMPase 2
UniProt Entry Name
IMPA2_HUMAN

NCBI Description

This locus encodes an inositol monophosphatase. The encoded protein catalyzes the dephosphoylration of inositol monophosphate and plays an important role in phosphatidylinositol signaling. This locus may be associated with susceptibility to bipolar disorder. [provided by RefSeq, Jan 2011]

Uniprot Description

IMPA2: Can use myo-inositol monophosphates, scylloinositol 1,4- diphosphate, glucose-1-phosphate, beta-glycerophosphate, and 2'- AMP as substrates. Has been implicated as the pharmacological target for lithium Li(+) action in brain. Belongs to the inositol monophosphatase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Carbohydrate Metabolism - inositol phosphate; Phosphatase (non-protein); EC 3.1.3.25; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 18p11.2

Cellular Component: cytoplasm; cytosol

Molecular Function: protein homodimerization activity; metal ion binding; inositol-1(or 4)-monophosphatase activity

Biological Process: inositol phosphate metabolic process; phosphoinositide phosphorylation; inositol phosphate dephosphorylation; inositol biosynthetic process; signal transduction; phosphate metabolic process

Research Articles on IMPA2

Similar Products

Product Notes

The IMPA2 impa2 (Catalog #AAA642966) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The IMPA2 (Inositol Monophosphatase 2, IMP 2, IMPase 2, Inositol-1(or 4)-monophosphatase 2, Myo-inositol Monophosphatase A2, IMP.18P) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IMPA2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). Suitable for use in Western Blot and Immunohistochemistry. Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml. Researchers should empirically determine the suitability of the IMPA2 impa2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MKPSGEDQAA LAAGPWEECF QAAVQLALRA GQIIRKALTE EKRVSTKTSA ADLVTETDHL VEDLIISELR ERFPSHRFIA EEAAASGAKC VLTHSPTWII DPIDGTCNFV HRFPTVAVSI GFAVRQELEF GVIYHCTEER LYTGRRGRGA FCNGQRLRVS GETDLSKALV LTEIGPKRDP ATLKLFLSNM ERLLHAKAHG VRVIGSSTLA LCHLASGAAD AYYQFGLHCW DLAAATVIIR EAGGIVIDTS GGPLDLMACR VVAASTREMA MLIAQALQTI NYGRDDEK. It is sometimes possible for the material contained within the vial of "IMPA2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.