Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-IL9 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)

Rabbit IL9 Polyclonal Antibody | anti-IL9 antibody

IL9 antibody - middle region

Gene Names
IL9; P40; HP40; IL-9
Reactivity
Guinea Pig, Horse, Human, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IL9; Polyclonal Antibody; IL9 antibody - middle region; anti-IL9 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Guinea Pig, Horse, Human, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALT
Sequence Length
144
Applicable Applications for anti-IL9 antibody
Western Blot (WB)
Homology
Guinea Pig: 77%; Horse: 77%; Human: 100%; Rat: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human IL9
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-IL9 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)

Western Blot (WB) (WB Suggested Anti-IL9 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)
Related Product Information for anti-IL9 antibody
This is a rabbit polyclonal antibody against IL9. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: IL9 is a cytokine that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9 receptor (IL9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. The gene encoding IL9 has been identified as a candidate gene for asthma. Genetic studies on a mouse model of asthma demonstrated that IL9 is a determining factor in the pathogenesis of bronchial hyperresponsiveness. The protein encoded by this gene is a cytokine that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9 receptor (IL9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. The gene encoding this cytokine has been identified as a candidate gene for asthma. Genetic studies on a mouse model of asthma demonstrated that this cytokine is a determining factor in the pathogenesis of bronchial hyperresponsiveness. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14kDa
NCBI Official Full Name
interleukin-9
NCBI Official Synonym Full Names
interleukin 9
NCBI Official Symbol
IL9
NCBI Official Synonym Symbols
P40; HP40; IL-9
NCBI Protein Information
interleukin-9
UniProt Protein Name
Interleukin-9
Protein Family
UniProt Gene Name
IL9
UniProt Synonym Gene Names
IL-9
UniProt Entry Name
IL9_HUMAN

NCBI Description

The protein encoded by this gene is a cytokine that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9 receptor (IL9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. The gene encoding this cytokine has been identified as a candidate gene for asthma. Genetic studies on a mouse model of asthma demonstrated that this cytokine is a determining factor in the pathogenesis of bronchial hyperresponsiveness. [provided by RefSeq, Jul 2008]

Uniprot Description

IL9: Supports IL-2 independent and IL-4 independent growth of helper T-cells. Belongs to the IL-7/IL-9 family.

Protein type: Secreted; Secreted, signal peptide; Cytokine

Chromosomal Location of Human Ortholog: 5q31.1

Cellular Component: extracellular space

Molecular Function: growth factor activity; interleukin-9 receptor binding; cytokine activity

Biological Process: positive regulation of cell proliferation; immune response; inflammatory response; positive regulation of cell growth; positive regulation of interleukin-5 biosynthetic process

Research Articles on IL9

Similar Products

Product Notes

The IL9 il9 (Catalog #AAA3211607) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IL9 antibody - middle region reacts with Guinea Pig, Horse, Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's IL9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IL9 il9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SQMTNTTMQT RYPLIFSRVK KSVEVLKNNK CPYFSCEQPC NQTTAGNALT. It is sometimes possible for the material contained within the vial of "IL9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.