Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (87.27kD).)

Mouse TLR10 Monoclonal Antibody | anti-TLR10 antibody

TLR10 (Toll-like Receptor 10, CD290, UNQ315/PRO358) (AP)

Gene Names
TLR10; CD290
Reactivity
Human, Mouse, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TLR10; Monoclonal Antibody; TLR10 (Toll-like Receptor 10; CD290; UNQ315/PRO358) (AP); anti-TLR10 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2A11
Specificity
Recognizes human TLR10. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-TLR10 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-811 from human TLR10 (NP_112218.2) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DAPELPEERELMTNCSNMSLRKVPADLTPATTTLDLSYNLLFQLQSSDFHSVSKLRVLILCHNRIQQLDLKTFEFNKELRYLDLSNNRLKSVTWYLLAGLRYLDLSFNDFDTMPICEEAGNMSHLEILGLSGAKIQKSDFQKIAHLHLNTVFLGFRTLPHYEEGSLPILNTTKLHIVLPMDTNFWVLLRDGIKTSKILEMTNIDGKSQFVSYEMQRNLSLENAKTSVLLLNKVDLLWDDLFLILQFVWHTSVEHF
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (87.27kD).)

Western Blot (WB) (Western Blot detection against Immunogen (87.27kD).)

Western Blot (WB)

(TLR10 monoclonal antibody, Western Blot analysis of TLR10 expression in PC-12.)

Western Blot (WB) (TLR10 monoclonal antibody, Western Blot analysis of TLR10 expression in PC-12.)

Western Blot (WB)

(TLR10 monoclonal antibody, Western Blot analysis of TLR10 expression in Raw 264.7.)

Western Blot (WB) (TLR10 monoclonal antibody, Western Blot analysis of TLR10 expression in Raw 264.7.)

Western Blot (WB)

(TLR10 monoclonal antibody. Western Blot analysis of TLR10 expression in NIH/3T3.)

Western Blot (WB) (TLR10 monoclonal antibody. Western Blot analysis of TLR10 expression in NIH/3T3.)
Product Categories/Family for anti-TLR10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
94,564 Da
NCBI Official Full Name
toll-like receptor 10 isoform a
NCBI Official Synonym Full Names
toll-like receptor 10
NCBI Official Symbol
TLR10
NCBI Official Synonym Symbols
CD290
NCBI Protein Information
toll-like receptor 10
UniProt Protein Name
Toll-like receptor 10
Protein Family
UniProt Gene Name
TLR10
UniProt Entry Name
TLR10_HUMAN

NCBI Description

The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is most highly expressed in lymphoid tissues such as spleen, lymph node, thymus, and tonsil. Multiple alternatively spliced transcript variants which encode different protein isoforms have been found for this gene. [provided by RefSeq, Aug 2010]

Uniprot Description

TLR10: Participates in the innate immune response to microbial agents. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Belongs to the Toll-like receptor family.

Protein type: Receptor, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 4p14

Cellular Component: membrane; integral to membrane; plasma membrane

Molecular Function: transmembrane receptor activity

Biological Process: toll-like receptor 5 signaling pathway; MyD88-dependent toll-like receptor signaling pathway; regulation of cytokine secretion; toll-like receptor signaling pathway; innate immune response; immune response; inflammatory response; positive regulation of inflammatory response; toll-like receptor 10 signaling pathway

Research Articles on TLR10

Similar Products

Product Notes

The TLR10 tlr10 (Catalog #AAA6134218) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TLR10 (Toll-like Receptor 10, CD290, UNQ315/PRO358) (AP) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TLR10 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TLR10 tlr10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TLR10, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.