Rabbit anti-Human IL9 Polyclonal Antibody | anti-IL9 antibody

IL9 (Cytokine P40, T-cell Growth Factor P40, Interleukin-9, IL-9, IL9, Cytokine P40) (FITC)

Cat. Num. AAA6382841

• Gene Names: IL9; P40; HP40; IL-9
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: IL9; Polyclonal Antibody; IL9 (Cytokine P40; T-cell Growth Factor P40; Interleukin-9; IL-9; Cytokine P40) (FITC); anti-IL9 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human IL9.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).

• Applicable Applications for anti-IL9 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human IL9, aa1-144 (NP_000581.1).
• Immunogen Sequence: MLLAMVLTSALLLCSVAGQGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI
• Conjugate: FITC
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of IL9 expression in transfected 293T cell line by IL9 polyclonal antibody. Lane 1: IL9 transfected lysate (15.9kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-IL9 antibody

IL9 is a cytokine that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9 receptor (IL9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes.

Product Categories/Family for anti-IL9 antibody

Antibodies; Interleukin

NCBI and Uniprot Product Information

• NCBI GI #: 10834980
• NCBI GeneID: 3578
• NCBI Accession #: NP_000581.1
• NCBI GenBank Nucleotide #: NM_000590
• UniProt Accession #: P15248
• Molecular Weight: 15,909 Da
• NCBI Official Full Name: interleukin-9
• NCBI Official Synonym Full Names: interleukin 9
• NCBI Official Symbol: IL9
• NCBI Official Synonym Symbols: P40; HP40; IL-9
• NCBI Protein Information: interleukin-9; cytokine P40; p40 cytokine; T-cell growth factor p40; p40 T-cell and mast cell growth factor; homolog of mouse T cell and mast cell growth factor 40
• UniProt Protein Name: Interleukin-9
• Protein Family: Interleukin
• UniProt Gene Name: IL9
• UniProt Synonym Gene Names: IL-9
• UniProt Entry Name: IL9_HUMAN

NCBI Description

The protein encoded by this gene is a cytokine that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9 receptor (IL9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. The gene encoding this cytokine has been identified as a candidate gene for asthma. Genetic studies on a mouse model of asthma demonstrated that this cytokine is a determining factor in the pathogenesis of bronchial hyperresponsiveness. [provided by RefSeq, Jul 2008]

Uniprot Description

IL9: Supports IL-2 independent and IL-4 independent growth of helper T-cells. Belongs to the IL-7/IL-9 family.

Protein type: Secreted; Secreted, signal peptide; Cytokine

Chromosomal Location of Human Ortholog: 5q31.1

Cellular Component: extracellular space

Molecular Function: growth factor activity; interleukin-9 receptor binding; cytokine activity

Biological Process: positive regulation of cell proliferation; immune response; inflammatory response; positive regulation of cell growth; positive regulation of interleukin-5 biosynthetic process