Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-IL4I1 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole Cell)

Rabbit anti-Human IL4I1 Polyclonal Antibody | anti-IL4I1 antibody

IL4I1 Antibody - C-terminal region

Gene Names
IL4I1; LAO; FIG1; LAAO
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IL4I1; Polyclonal Antibody; IL4I1 Antibody - C-terminal region; anti-IL4I1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PHGWVETAVKSALRAAIKINSRKGPASDTASPEGHASDMEGQGHVHGVAS
Sequence Length
567
Applicable Applications for anti-IL4I1 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human IL4I1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-IL4I1 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole Cell)

Western Blot (WB) (WB Suggested Anti-IL4I1 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole Cell)
Related Product Information for anti-IL4I1 antibody
This is a rabbit polyclonal antibody against IL4I1. It was validated on Western Blot

Target Description: The protein encoded by this gene shares the limited similarity with L-amino acid oxidase, and contains the conserved key amino acid residues thought to be involved in catalysis and binding of the flavin adenine dinucleotide cofactor. The expression of this gene can be induced by interleukin 4 in B cells. Two alternatively spliced transcript variants of this gene encoding two distinct isoforms have been reported.
Product Categories/Family for anti-IL4I1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61kDa
NCBI Official Full Name
L-amino-acid oxidase isoform 1
NCBI Official Synonym Full Names
interleukin 4 induced 1
NCBI Official Symbol
IL4I1
NCBI Official Synonym Symbols
LAO; FIG1; LAAO
NCBI Protein Information
L-amino-acid oxidase
UniProt Protein Name
L-amino-acid oxidase
UniProt Gene Name
IL4I1
UniProt Synonym Gene Names
FIG1; LAAO; LAO; IL4-induced protein 1; hFIG1
UniProt Entry Name
OXLA_HUMAN

NCBI Description

This gene encodes a protein with limited similarity to L-amino acid oxidase which contains the conserved amino acids thought to be involved in catalysis and binding of flavin adenine dinucleotide (FAD) cofactor. The expression of this gene can be induced by interleukin 4 in B cells, however, expression of transcripts containing the first two exons of the upstream gene is found in other cell types. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2012]

Uniprot Description

IL4I1: Lysosomal L-amino-acid oxidase with highest specific activity with phenylalanine. May play a role in lysosomal antigen processing and presentation. Belongs to the flavin monoamine oxidase family. FIG1 subfamily. 2 isoforms of the human protein are produced by alternative promoter.

Protein type: Amino Acid Metabolism - phenylalanine; Amino Acid Metabolism - phenylalanine, tyrosine and tryptophan biosynthesis; Amino Acid Metabolism - valine, leucine and isoleucine degradation; Oxidoreductase; Amino Acid Metabolism - cysteine and methionine; Amino Acid Metabolism - alanine, aspartate and glutamate; EC 1.4.3.2; Secreted; Amino Acid Metabolism - tyrosine; Amino Acid Metabolism - tryptophan; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 19q13.3-q13.4

Cellular Component: lysosome; extracellular region

Molecular Function: L-amino-acid oxidase activity

Research Articles on IL4I1

Similar Products

Product Notes

The IL4I1 il4i1 (Catalog #AAA3216789) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IL4I1 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IL4I1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IL4I1 il4i1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PHGWVETAVK SALRAAIKIN SRKGPASDTA SPEGHASDME GQGHVHGVAS. It is sometimes possible for the material contained within the vial of "IL4I1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.