Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Immunoperoxidase of monoclonal antibody to YY1 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 3 ug/ml])

Mouse YY1 Monoclonal Antibody | anti-YY1 antibody

YY1 (YY1 Transcription Factor, DELTA, INO80S, NF-E1, UCRBP, YIN-YANG-1) (Biotin)

Gene Names
YY1; DELTA; NF-E1; UCRBP; GADEVS; INO80S; YIN-YANG-1
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
YY1; Monoclonal Antibody; YY1 (YY1 Transcription Factor; DELTA; INO80S; NF-E1; UCRBP; YIN-YANG-1) (Biotin); YY1 Transcription Factor; YIN-YANG-1; anti-YY1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4D2
Specificity
Recognizes YY1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-YY1 antibody
Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
YY1 (NP_003394, 221aa-320aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTH
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to YY1 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 3 ug/ml])

Testing Data (Immunoperoxidase of monoclonal antibody to YY1 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to YY1 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to YY1 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 3 ug/ml])

Western Blot (WB)

(YY1 monoclonal antibody (M03), clone 4D2 Western Blot analysis of YY1 expression in Hela S3 NE.)

Western Blot (WB) (YY1 monoclonal antibody (M03), clone 4D2 Western Blot analysis of YY1 expression in Hela S3 NE.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to YY1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to YY1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to YY1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to YY1 on HeLa cell. [antibody concentration 10 ug/ml])

Testing Data

(Detection limit for recombinant GST tagged YY1 is approximately 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged YY1 is approximately 0.03ng/ml as a capture antibody.)
Related Product Information for anti-YY1 antibody
YY1 is a ubiquitously distributed transcription factor belonging to the GLI-Kruppel class of zinc finger proteins. The protein is involved in repressing and activating a diverse number of promoters. YY1 may direct histone deacetylases and histone acetyltransferases to a promoter in order to activate or repress the promoter, thus implicating histone modification in the function of YY1. [provided by RefSeq]
Product Categories/Family for anti-YY1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47.1kDa (437aa) confirmed by MALDI-TOF (Molecular size on SDS-PAGE will appear higher)
NCBI Official Full Name
transcriptional repressor protein YY1
NCBI Official Synonym Full Names
YY1 transcription factor
NCBI Official Symbol
YY1
NCBI Official Synonym Symbols
DELTA; NF-E1; UCRBP; GADEVS; INO80S; YIN-YANG-1
NCBI Protein Information
transcriptional repressor protein YY1
UniProt Protein Name
Transcriptional repressor protein YY1
Protein Family
UniProt Gene Name
YY1
UniProt Synonym Gene Names
INO80S; YY-1
UniProt Entry Name
TYY1_HUMAN

NCBI Description

YY1 is a ubiquitously distributed transcription factor belonging to the GLI-Kruppel class of zinc finger proteins. The protein is involved in repressing and activating a diverse number of promoters. YY1 may direct histone deacetylases and histone acetyltransferases to a promoter in order to activate or repress the promoter, thus implicating histone modification in the function of YY1. [provided by RefSeq, Jul 2008]

Research Articles on YY1

Similar Products

Product Notes

The YY1 yy1 (Catalog #AAA6170599) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's YY1 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the YY1 yy1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "YY1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.