anti-Human, Rat IGFBP3 Polyclonal Antibody | anti-IGFBP3 antibody

Anti-IGFBP3 Antibody

Cat. Num. AAA178228

• Gene Names: IGFBP3; IBP3; BP-53
• Reactivity: Human, Rat
• Applications: Western Blot, Immunohistochemistry, ELISA
• Purity: Immunogen Affinity Purified
• Synonyms: IGFBP3; Polyclonal Antibody; Anti-IGFBP3 Antibody; Insulin-like growth factor-binding protein 3; Acid stable subunit of the 140 K IGF complex; Binding protein 29; Binding protein 53; BP 53; BP53; Growth hormone dependent binding protein; IBP 3; IBP-3; IBP3; IBP3_HUMAN; IGF binding protein 3; IGF-binding protein 3; IGFBP 3; IGFBP-3; Insulin Like Growth Factor Binding Protein 3; insulin-like growth factor binding protein 3; anti-IGFBP3 antibody

• Reactivity: Human, Rat
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 291

• Applicable Applications for anti-IGFBP3 antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin, ELISA (EIA)
• Application Notes: ELISA Concentration: 0.1-0.5ug/ml; Western Blot Concentration: 0.1-0.5ug/ml; Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human IGFBP3 (214-252aa RREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCR), identical to the related mouse and rat sequences.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- IGFBP-3 Picoband antibody, MBS178228, Western blottingAll lanes: Anti IGFBP-3 (MBS178228) at 0.5ug/mlLane 1: Rat Kidney Tissue Lysate at 50ugLane 2: Rat Liver Tissue Lysate at 50ugLane 3: SGC Whole Cell Lysate at 40ugLane 4: 22RV1 Whole Cell Lysate at 40ugPredicted bind size: 31KDObserved bind size: 31KD )

Immunohistochemistry (IHC)

(Anti- IGFBP-3 Picoband antibody, MBS178228, IHC(P)IHC(P): Human Intestinal Cancer Tissue )

Related Product Information for anti-IGFBP3 antibody

Description: Rabbit IgG polyclonal antibody for Insulin-like growth factor-binding protein 3(IGFBP3) detection. Tested with WB, IHC-P, ELISA in Human;Rat.

Background: IGFBP3, Insulin-like growth fator-binding protein 3, is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. IGFBP3 is located on chromosome 7. The protein forms a ternary complex with insulin-like growth factor acid-labile subunit (IGFALS) and either insulin-like growth factor (IGF) I or II. In this form, it circulates in the plasma, prolonging the half-life of IGFs and altering their interaction with cell surface receptors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

References

1. Lofqvist, C., Chen, J., Connor, K. M., Smith, A. C. H., Aderman, C. M., Liu, N., Pintar, J. E., Ludwig, T., Hellstrom, A., Smith, L. E. H. IGFBP3 suppresses retinopathy through suppression of oxygen-induced vessel loss and promotion of vascular regrowth.Proc. Nat. Acad. Sci. 104: 10589-10594, 2007. 2. Nwosu BU, et al. Evidence of insulin-like growth factor binding protein-3 proteolysis during growth hormone stimulation testing. J Pediatr Endocrinol Metab, 2011. 3. Relationship of insulin-like growth factor (IGF) binding protein-3 (IGFBP-3) gene polymorphism with the susceptibility to development of prostate cancer and influence on serum levels of IGF-I, and IGFBP-3. Safarinejad MR, et al. Growth Horm IGF Res, 2011 Jun.

NCBI and Uniprot Product Information

• NCBI GI #: 62243068
• NCBI GeneID: 3486
• NCBI Accession #: NP_000589.2
• NCBI GenBank Nucleotide #: NM_000598.4
• UniProt Accession #: P17936; Q2V509; Q6P1M6; Q9UCL4; A4D2F5; D3DVM0
• Molecular Weight: 32,223 Da
• NCBI Official Full Name: insulin-like growth factor-binding protein 3 isoform b
• NCBI Official Synonym Full Names: insulin like growth factor binding protein 3
• NCBI Official Symbol: IGFBP3
• NCBI Official Synonym Symbols: IBP3; BP-53
• NCBI Protein Information: insulin-like growth factor-binding protein 3
• UniProt Protein Name: Insulin-like growth factor-binding protein 3
• Protein Family: Insulin-like growth factor-binding protein
• UniProt Gene Name: IGFBP3
• UniProt Synonym Gene Names: IBP3; IBP-3; IGF-binding protein 3; IGFBP-3
• UniProt Entry Name: IBP3_HUMAN

NCBI Description

This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein forms a ternary complex with insulin-like growth factor acid-labile subunit (IGFALS) and either insulin-like growth factor (IGF) I or II. In this form, it circulates in the plasma, prolonging the half-life of IGFs and altering their interaction with cell surface receptors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

IGFBP3: IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Also exhibits IGF-independent antiproliferative and apoptotic effects mediated by its receptor TMEM219/IGFBP-3R.

Protein type: Secreted; Cell development/differentiation; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 7p12.3

Cellular Component: extracellular region; extracellular space; insulin-like growth factor binding protein complex; nucleus

Molecular Function: fibronectin binding; insulin-like growth factor binding; insulin-like growth factor I binding; insulin-like growth factor II binding; metal ion binding; protein binding; protein tyrosine phosphatase activator activity

Biological Process: apoptosis; cellular protein metabolic process; negative regulation of cell proliferation; negative regulation of protein amino acid phosphorylation; negative regulation of signal transduction; negative regulation of smooth muscle cell migration; negative regulation of smooth muscle cell proliferation; osteoblast differentiation; positive regulation of apoptosis; positive regulation of catalytic activity; positive regulation of insulin-like growth factor receptor signaling pathway; positive regulation of MAPKKK cascade; positive regulation of myoblast differentiation; protein amino acid phosphorylation; regulation of apoptosis; regulation of cell growth; regulation of insulin-like growth factor receptor signaling pathway