anti-Mouse, Rat IGFBP1 Polyclonal Antibody | anti-IGFBP1 antibody

Anti-IGFBP1 Antibody

Cat. Num. AAA177666

• Reactivity: Mouse, Rat
• Applications: Western Blot, ELISA
• Purity: Immunogen Affinity Purified
• Synonyms: IGFBP1; Polyclonal Antibody; Anti-IGFBP1 Antibody; Insulin-like growth factor-binding protein 1; AFBP; Alpha pregnancy associated endometrial globulin; Amniotic fluid binding protein; Binding protein 25; Binding protein 26; Binding protein 28; Growth hormone independent binding protein; hIGFBP 1; hIGFBP1; IBP 1; IBP-1; IBP1; IBP1_HUMAN; IGF binding protein 1; IGF BP25; IGF-binding protein 1; IGFBP 1; IGFBP-1; Insulin Like Growth Factor Binding Protein 1; Placental protein 12; PP 12; PP12; insulin-like growth factor binding protein 1; anti-IGFBP1 antibody

• Reactivity: Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 272

• Applicable Applications for anti-IGFBP1 antibody: Western Blot (WB), ELISA (EIA)
• Application Notes: ELISA Concentration: 0.1-0.5ug/ml; Western Blot Concentration: 0.1-0.5ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of mouse IGFBP1 (177-207aa REIADLKKWKEPCQRELYKVLERLAAAQQKA), different from the related human sequence by eleven amino acids, and from the related rat sequence by one amino acid.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- IGFBP-1 Picoband antibody, MBS177666, Western blottingAll lanes: Anti IGFBP-1 (MBS177666) at 0.5ug/mlLane 1: Rat Kidney Tissue Lysate at 50ugLane 2: Mouse Kidney Tissue Lysate at 50ugPredicted bind size: 28KDObserved bind size: 28KD)

Related Product Information for anti-IGFBP1 antibody

Description: Rabbit IgG polyclonal antibody for Insulin-like growth factor-binding protein 1(IGFBP1) detection. Tested with WB, ELISA in Mouse;Rat.

Background: IGFBP1, Insulin-like growth factor-binding protein 1, also known as placental protein 12 (PP12), is a protein that in humans is encoded by the IGFBP1 gene. The IGFBP1 gene has 4 exons and spans 5.9 kb. And the IGFBP1gene is localized to 7p13-p12 by in situ hybridization. This gene is a member of the Insulin-like growth factor-binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a type-I thyroglobulin domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

References

1. Alitalo, T., Kontula, K., Koistinen, R., Aalto-Setala, K., Julkunen, M., Janne, O. A., Seppala, M., de la Chapelle, A.The gene encoding human low-molecular weight insulin-like growth-factor binding protein (IGF-BP25): regional localization to 7p12-p13 and description of a DNA polymorphism.Hum. Genet. 83: 335-338, 1989. 2. Brinkman, A., Groffen, C. A. H., Kortleve, D. J., Drop, S. L. S.Organization of the gene encoding the insulin-like growth factor binding protein IBP-1.Biochem. Biophys. Res. Commun. 157: 898-907, 1988. 3. Leu, J. I.-J., George, D. L.Hepatic IGFBP1 is a prosurvival factor that binds to BAK, protects the liver from apoptosis, and antagonizes the proapoptotic actions of p53 at mitochondria.Genes Dev. 21: 3095-3109, 2007.

NCBI and Uniprot Product Information

• NCBI GI #: 160358847
• NCBI GeneID: 16006
• NCBI Accession #: NP_032367.3
• NCBI GenBank Nucleotide #: NM_008341.4
• UniProt Accession #: P47876; Q5SVY8; Q61732
• Molecular Weight: 29,570 Da
• NCBI Official Full Name: insulin-like growth factor-binding protein 1
• NCBI Official Synonym Full Names: insulin-like growth factor binding protein 1
• NCBI Official Symbol: Igfbp1
• NCBI Protein Information: insulin-like growth factor-binding protein 1
• UniProt Protein Name: Insulin-like growth factor-binding protein 1
• Protein Family: Insulin-like growth factor-binding protein
• UniProt Gene Name: Igfbp1
• UniProt Synonym Gene Names: Igfbp-1; IBP-1; IGF-binding protein 1; IGFBP-1
• UniProt Entry Name: IBP1_MOUSE

Uniprot Description

IGFBP1: IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Promotes cell migration.

Protein type: Secreted, signal peptide; Secreted

Cellular Component: extracellular region; extracellular space

Molecular Function: growth factor binding; insulin-like growth factor binding; insulin-like growth factor I binding; insulin-like growth factor II binding

Biological Process: regulation of cell growth; regulation of insulin-like growth factor receptor signaling pathway