SDS-Page
60 kDa SS-A/Ro ribonucleoprotein (TROVE2) Recombinant Protein | TROVE2 recombinant protein
Recombinant Human 60 kDa SS-A/Ro ribonucleoprotein (TROVE2)
Gene Names
TROVE2; RO60; SSA2; RORNP
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
60 kDa SS-A/Ro ribonucleoprotein (TROVE2); Recombinant Human 60 kDa SS-A/Ro ribonucleoprotein (TROVE2); 60 kDa SS-A/Ro ribonucleoprotein; 60 kDa Ro protein; 60 kDa ribonucleoprotein Ro; RoRNP; Ro 60 kDa autoantigen; Sjoegren syndrome antigen A2; Sjoegren syndrome type A antigen; SS-A; TROVE domain family member 2; TROVE2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
3-535aa; Partial
Sequence
ESVNQMQPLNEKQIANSQDGYVWQVTDMNRLHRFLCFGSEGGTYYIKEQKLGLENAEALIRLIEDGRGCEVIQEIKSFSQEGRTTKQEPMLFALAICSQCSDISTKQAAFKAVSEVCRIPTHLFTFIQFKKDLKESMKCGMWGRALRKAIADWYNEKGGMALALAVTKYKQRNGWSHKDLLRLSHLKPSSEGLAIVTKYITKGWKEVHELYKEKALSVETEKLLKYLEAVEKVKRTRDELEVIHLIEEHRLVREHLLTNHLKSKEVWKALLQEMPLTALLRNLGKMTANSVLEPGNSEVSLVCEKLCNEKLLKKARIHPFHILIALETYKTGHGLRGKLKWRPDEEILKALDAAFYKTFKTVEPTGKRFLLAVDVSASMNQRVLGSILNASTVAAAMCMVVTRTEKDSYVVAFSDEMVPCPVTTDMTLQQVLMAMSQIPAGGTDCSLPMIWAQKTNTPADVFIVFTDNETFAGGVHPAIALREYRKKMDIPAKLIVCGMTSNGFTIADPDDRGMLDMCGFDTGALDVIRNFTL
Sequence Length
535
Species
Homo sapiens (Human)
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-Page
SDS-Page
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
64.1 kDa
NCBI Official Full Name
60 kDa SS-A/Ro ribonucleoprotein isoform 1
NCBI Official Synonym Full Names
TROVE domain family, member 2
NCBI Official Symbol
TROVE2
NCBI Official Synonym Symbols
RO60; SSA2; RORNP
NCBI Protein Information
60 kDa SS-A/Ro ribonucleoprotein; 60 kDa ribonucleoprotein Ro; sjoegren syndrome type A antigen; gastric cancer multi-drug resistance protein; Sjogren syndrome antigen A2 (60kD, ribonucleoprotein autoantigen SS-A/Ro)
UniProt Protein Name
60 kDa SS-A/Ro ribonucleoprotein
Protein Family
UniProt Gene Name
TROVE2
UniProt Synonym Gene Names
RO60; SSA2; 60 kDa Ro protein; 60 kDa ribonucleoprotein Ro; RoRNP; SS-A
UniProt Entry Name
RO60_HUMAN
Uniprot Description
SSA2: RNA-binding protein that binds to several small cytoplasmic RNA molecules known as Y RNAs. May stabilize these RNAs from degradation. Belongs to the Ro 60 kDa family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: RNA-binding
Chromosomal Location of Human Ortholog: 1q31
Cellular Component: nucleoplasm; cytoplasm; ribonucleoprotein complex
Molecular Function: RNA binding; metal ion binding; U2 snRNA binding
Biological Process: transcription from RNA polymerase III promoter; immune system development; smoothened signaling pathway; response to UV
Disease: Heart Block, Congenital
Research Articles on TROVE2
Similar Products
Product Notes
The TROVE2 trove2 (Catalog #AAA952947) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 3-535aa; Partial. The amino acid sequence is listed below: ESVNQMQPLN EKQIANSQDG YVWQVTDMNR LHRFLCFGSE GGTYYIKEQK LGLENAEALI RLIEDGRGCE VIQEIKSFSQ EGRTTKQEPM LFALAICSQC SDISTKQAAF KAVSEVCRIP THLFTFIQFK KDLKESMKCG MWGRALRKAI ADWYNEKGGM ALALAVTKYK QRNGWSHKDL LRLSHLKPSS EGLAIVTKYI TKGWKEVHEL YKEKALSVET EKLLKYLEAV EKVKRTRDEL EVIHLIEEHR LVREHLLTNH LKSKEVWKAL LQEMPLTALL RNLGKMTANS VLEPGNSEVS LVCEKLCNEK LLKKARIHPF HILIALETYK TGHGLRGKLK WRPDEEILKA LDAAFYKTFK TVEPTGKRFL LAVDVSASMN QRVLGSILNA STVAAAMCMV VTRTEKDSYV VAFSDEMVPC PVTTDMTLQQ VLMAMSQIPA GGTDCSLPMI WAQKTNTPAD VFIVFTDNET FAGGVHPAIA LREYRKKMDI PAKLIVCGMT SNGFTIADPD DRGMLDMCGF DTGALDVIRN FTL. It is sometimes possible for the material contained within the vial of "60 kDa SS-A/Ro ribonucleoprotein (TROVE2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
