Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: IDSSample Tissue: Mouse Kidney lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Mouse IDS Polyclonal Antibody | anti-IDS antibody

IDS Antibody - middle region

Gene Names
Ids; AW214631
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
IDS; Polyclonal Antibody; IDS Antibody - middle region; anti-IDS antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SWSFPPYHPSSEKYENTKTCKGQDGKLHANLLCPVDVADVPEGTLPDKQS
Sequence Length
552
Applicable Applications for anti-IDS antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse IDS
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: IDSSample Tissue: Mouse Kidney lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: IDSSample Tissue: Mouse Kidney lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-IDS antibody
Required for the lysosomal degradation of heparan sulfate and dermatan sulfate.
Product Categories/Family for anti-IDS antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60 kDa
NCBI Official Full Name
iduronate 2-sulfatase
NCBI Official Synonym Full Names
iduronate 2-sulfatase
NCBI Official Symbol
Ids
NCBI Official Synonym Symbols
AW214631
NCBI Protein Information
iduronate 2-sulfatase
UniProt Protein Name
Iduronate 2-sulfatase
Protein Family
UniProt Gene Name
Ids
UniProt Entry Name
IDS_MOUSE

Uniprot Description

IDS: Required for the lysosomal degradation of heparan sulfate and dermatan sulfate. Defects in IDS are the cause of mucopolysaccharidosis type 2 (MPS2); also known as Hunter syndrome. MPS2 is an X-linked lysosomal storage disease characterized by intracellular accumulation of heparan sulfate and dermatan sulfate and their excretion in urine. Most children with MPS2 have a severe form with early somatic abnormalities including skeletal deformities, hepatosplenomegaly, and progressive cardiopulmonary deterioration. A prominent feature is neurological damage that presents as developmental delay and hyperactivity but progresses to mental retardation and dementia. They die before 15 years of age, usually as a result of obstructive airway disease or cardiac failure. In contrast, those with a mild form of MPS2 may survive into adulthood, with attenuated somatic complications and often without mental retardation. Belongs to the sulfatase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Hydrolase; EC 3.1.6.13; Glycan Metabolism - glycosaminoglycan degradation

Cellular Component: lysosome

Molecular Function: catalytic activity; hydrolase activity; iduronate-2-sulfatase activity; metal ion binding; protein binding; sulfuric ester hydrolase activity

Biological Process: metabolic process

Research Articles on IDS

Similar Products

Product Notes

The IDS ids (Catalog #AAA3223532) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IDS Antibody - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's IDS can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IDS ids for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SWSFPPYHPS SEKYENTKTC KGQDGKLHAN LLCPVDVADV PEGTLPDKQS. It is sometimes possible for the material contained within the vial of "IDS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.