Western Blot (WB)
(OXSR1 monoclonal antibody (M09), clone 5D5 Western Blot analysis of OXSR1 expression in HeLa.)
Mouse OXSR1 Monoclonal Antibody | anti-OXSR1 antibody
OXSR1 (Oxidative-Stress Responsive 1, KIAA1101, OSR1) (APC)
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
OXSR1; Monoclonal Antibody; OXSR1 (Oxidative-Stress Responsive 1; KIAA1101; OSR1) (APC); Oxidative-Stress Responsive 1; OSR1; anti-OXSR1 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
5D5
Specificity
Recognizes OXSR1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
527
Applicable Applications for anti-OXSR1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
OXSR1 (AAH08726.1, 351aa-450aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KAAISQLRSPRVKESISNSELFPTTDPVGTLLQVPEQISAHLPQPAGQIATQPTQVSLPPTAEPAKTAQALSSGSGSQETKIPISLVLRLRNSKKELNDI
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(OXSR1 monoclonal antibody (M09), clone 5D5 Western Blot analysis of OXSR1 expression in HeLa.)
Western Blot (WB)
(OXSR1 monoclonal antibody (M09), clone 5D5 Western Blot analysis of OXSR1 expression in HeLa.)
Related Product Information for anti-OXSR1 antibody
The product of this gene belongs to the Ser/Thr protein kinase family of proteins. It regulates downstream kinases in response to environmental stress, and may play a role in regulating the actin cytoskeleton. [provided by RefSeq]
Product Categories/Family for anti-OXSR1 antibody
References
1. Common noncoding UMOD gene variants induce salt-sensitive hypertension and kidney damage by increasing uromodulin expression. Trudu M, Janas S, Lanzani C, Debaix H, Schaeffer C, Ikehata M, Citterio L, Demaretz S, Trevisani F, Ristagno G, Glaudemans B, Laghmani KNat Med. 2013 Dec;19(12):1655-60. doi: 10.1038/nm.3384. Epub 2013 Nov 3. 2.Impaired KLHL3-Mediated Ubiquitination of WNK4 Causes Human Hypertension.Wakabayashi M, Mori T, Isobe K, Sohara E, Susa K, Araki Y, Chiga M, Kikuchi E, Nomura N, Mori Y, Matsuo H, Murata T, Nomura S, Asano T, Kawaguchi H, Nonoyama S, Rai T, Sasaki S, Uchida SCell Rep. 2013 Feb 27. pii: S2211-1247(13)00100-9. doi: 10.1016/j.celrep.2013.02.024. 3. WNK-OSR1/SPAK-NCC signal cascade has circadian rhythm dependent on aldosterone.Susa K, Sohara E, Isobe K, Chiga M, Rai T, Sasaki S, Uchida S.Biochem Biophys Res Commun. 2012 Nov 2;427(4):743-7. doi: 10.1016/ j.bbrc.2012.09.130. Epub 2012 Oct 5. 4.Effect of heterozygous deletion of WNK1 on the WNK-OSR1/SPAK-NCC/NKCC1/NKCC2 signal cascade in the kidney and blood vessels.Susa K, Kita S, Iwamoto T, Yang SS, Lin SH, Ohta A, Sohara E, Rai T, Sasaki S, Alessi DR, Uchida S.Clin Exp Nephrol. 2012 Feb 1. 5.Phenotypes of pseudohypoaldosteronism type II caused by the WNK4 D561A missense mutation are dependent on the WNK-OSR1/SPAK kinase cascade. Chiga M, Rafiqi FH, Alessi DR, Sohara E, Ohta A, Rai T, Sasaki S, Uchida S.J Cell Sci. 2011 May 1;124(Pt 9):1391-5. Epub 2011 Apr 12.
NCBI and Uniprot Product Information
NCBI GI #
NCBI Official Full Name
Oxidative-stress responsive 1
Protein Family
Similar Products
Product Notes
The OXSR1 (Catalog #AAA6167109) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's OXSR1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the OXSR1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "OXSR1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
