Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: TREHSample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human TREH Polyclonal Antibody | anti-TREH antibody

TREH Antibody - middle region

Gene Names
TREH; TRE; TREA; TREHD
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
TREH; Polyclonal Antibody; TREH Antibody - middle region; anti-TREH antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IETLALELDFWTKNRTVSVSLEGKNYLLNRYYVPYGGPRPESYSKDVELA
Sequence Length
552
Applicable Applications for anti-TREH antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TREH
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: TREHSample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: TREHSample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-TREH antibody
This gene encodes an enzyme that hydrolyses trehalose, a disaccharide formed from two glucose molecules found mainly in fungi, plants, and insects. A partial duplication of this gene is located adjacent to this locus on chromosome 11. Two transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-TREH antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60 kDa
NCBI Official Full Name
trehalase isoform 2
NCBI Official Synonym Full Names
trehalase
NCBI Official Symbol
TREH
NCBI Official Synonym Symbols
TRE; TREA; TREHD
NCBI Protein Information
trehalase
UniProt Protein Name
Trehalase
Protein Family
UniProt Gene Name
TREH
UniProt Synonym Gene Names
TREA
UniProt Entry Name
TREA_HUMAN

NCBI Description

This gene encodes an enzyme that hydrolyses trehalose, a disaccharide formed from two glucose molecules found mainly in fungi, plants, and insects. A partial duplication of this gene is located adjacent to this locus on chromosome 11. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014]

Uniprot Description

TREH: Intestinal trehalase is probably involved in the hydrolysis of ingested trehalose. Deficiency of TREH results in isolated trehalose intolerance that causes gastrointestinal symptoms after ingestion of edible mushrooms. Belongs to the glycosyl hydrolase 37 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Carbohydrate Metabolism - starch and sucrose; EC 3.2.1.28; Membrane protein, GPI anchor; Hydrolase

Chromosomal Location of Human Ortholog: 11q23.3

Cellular Component: anchored to plasma membrane; plasma membrane

Molecular Function: alpha,alpha-trehalase activity

Biological Process: polysaccharide digestion; organ morphogenesis; trehalose catabolic process; trehalose metabolic process; carbohydrate metabolic process; pathogenesis

Disease: Trehalase Deficiency

Research Articles on TREH

Similar Products

Product Notes

The TREH treh (Catalog #AAA3222673) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TREH Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TREH can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TREH treh for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IETLALELDF WTKNRTVSVS LEGKNYLLNR YYVPYGGPRP ESYSKDVELA. It is sometimes possible for the material contained within the vial of "TREH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.