Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of Iba1 expression in human blood extract (lane 1). Iba1 at 17KD was detected using rabbit anti- Iba1 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Rabbit anti-Human Iba1 Polyclonal Antibody | anti-AIF1 antibody

Anti-Iba1 Antibody

Gene Names
AIF1; IBA1; IRT1; AIF-1; IRT-1
Reactivity
Human
Applications
Western Blot, Immunohistochemistry
Purity
Immunogen affinity purified.
Synonyms
Iba1; Polyclonal Antibody; Anti-Iba1 Antibody; AIF 1; AIF-1; AIF1 protein; allograft inflammatory factor 1; G1; IBA1; IBA 1; P55008; Allograft inflammatory factor 1; anti-AIF1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
93
Applicable Applications for anti-AIF1 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes
Western Blot: 0.1-0.5ug/ml
Immunohistochemistry(IHC) Paraffin: 0.5-1ug/ml
Notes
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Iba1 (99-133aa ETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEK), different from the related mouse sequence by seven amino acids, and from the related rat sequence by six amino acids.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of Iba1 expression in human blood extract (lane 1). Iba1 at 17KD was detected using rabbit anti- Iba1 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Western Blot (WB) (Western blot analysis of Iba1 expression in human blood extract (lane 1). Iba1 at 17KD was detected using rabbit anti- Iba1 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Immunohistochemistry (IHC)

(Iba1 was detected in paraffin-embedded sections of human lung cancer tissues using rabbit anti- Iba1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC) (Iba1 was detected in paraffin-embedded sections of human lung cancer tissues using rabbit anti- Iba1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC)

(Iba1 was detected in paraffin-embedded sections of human Appendicitis tissues using rabbit anti- Iba1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC) (Iba1 was detected in paraffin-embedded sections of human Appendicitis tissues using rabbit anti- Iba1 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )
Related Product Information for anti-AIF1 antibody
Rabbit IgG polyclonal antibody for Allograft inflammatory factor 1(AIF1) detection.
Background: Allograft inflammatory factor 1 (AIF-1), also known as ionized calcium-binding adapter molecule 1(IBA1), is a protein that in humans is encoded by the AIF1 gene. This gene encodes a protein that binds actin and calcium. And this gene is induced by cytokines and interferon and may promote macrophage activation and growth of vascular smooth muscle cells and T-lymphocytes. Polymorphisms in this gene may be associated with systemic sclerosis. Alternative splicing results in multiple transcript variants, but the full-length and coding nature of some of these variants is not certain.
References
1. "Entrez Gene: AIF1 allograft inflammatory factor 1".
2. Utans U, Arceci RJ, Yamashita Y, Russell ME (June 1995). "Cloning and characterization of allograft inflammatory factor-1: a novel macrophage factor identified in rat cardiac allografts with chronic rejection". J. Clin. Invest. 95 (6): 2954-62.
3. Tian Y, Jain S, Kelemen SE, Autieri MV (February 2009). "AIF-1 expression regulates endothelial cell activation, signal transduction, and vasculogenesis". Am. J. Physiol., Cell Physiol. 296 (2): C256-66.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
199
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14,617 Da
NCBI Official Full Name
allograft inflammatory factor 1 isoform 1
NCBI Official Synonym Full Names
allograft inflammatory factor 1
NCBI Official Symbol
AIF1
NCBI Official Synonym Symbols
IBA1; IRT1; AIF-1; IRT-1
NCBI Protein Information
allograft inflammatory factor 1
UniProt Protein Name
Allograft inflammatory factor 1
Protein Family
UniProt Gene Name
AIF1
UniProt Synonym Gene Names
G1; IBA1; AIF-1

NCBI Description

This gene encodes a protein that binds actin and calcium. This gene is induced by cytokines and interferon and may promote macrophage activation and growth of vascular smooth muscle cells and T-lymphocytes. Polymorphisms in this gene may be associated with systemic sclerosis. Alternative splicing results in multiple transcript variants, but the full-length and coding nature of some of these variants is not certain. [provided by RefSeq, Jan 2016]

Uniprot Description

AIF1: Actin-binding protein that enhances membrane ruffling and RAC activation. Enhances the actin-bundling activity of LCP1. Binds calcium. Plays a role in RAC signaling and in phagocytosis. May play a role in macrophage activation and function. Promotes the proliferation of vascular smooth muscle cells and of T- lymphocytes. Enhances lymphocyte migration. Plays a role in vascular inflammation. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytoskeletal

Chromosomal Location of Human Ortholog: 6p21.33

Cellular Component: actin filament; cytoplasm; cytosol; lamellipodium; nucleus; perinuclear region of cytoplasm; phagocytic cup

Molecular Function: actin filament binding; calcium ion binding

Biological Process: actin filament bundle formation; actin filament polymerization; inflammatory response; negative regulation of smooth muscle cell proliferation; phagocytosis, engulfment; positive regulation of smooth muscle cell proliferation; positive regulation of T cell proliferation; Rac protein signal transduction

Research Articles on AIF1

Similar Products

Product Notes

The AIF1 aif1 (Catalog #AAA178646) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-Iba1 Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Iba1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC) Paraffin. Western Blot: 0.1-0.5ug/ml Immunohistochemistry(IHC) Paraffin: 0.5-1ug/ml. Researchers should empirically determine the suitability of the AIF1 aif1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Iba1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.