Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-EFCAB4B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: NCI-H226 cell lysate)

Rabbit CRACR2A Polyclonal Antibody | anti-CRACR2A antibody

CRACR2A Antibody - N-terminal region

Gene Names
CRACR2A; EFCAB4B
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CRACR2A; Polyclonal Antibody; CRACR2A Antibody - N-terminal region; anti-CRACR2A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ARKDMQRLHKELPLSLEELEDVFDALDADGNGYLTPQEFTTGFSHFFFSQ
Sequence Length
395
Applicable Applications for anti-CRACR2A antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 92%; Rabbit: 79%; Rat: 85%; Zebrafish: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human EFCAB4B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-EFCAB4B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: NCI-H226 cell lysate)

Western Blot (WB) (WB Suggested Anti-EFCAB4B Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: NCI-H226 cell lysate)
Related Product Information for anti-CRACR2A antibody
This is a rabbit polyclonal antibody against EFCAB4B. It was validated on Western Blot using a cell lysate as a positive control.
Product Categories/Family for anti-CRACR2A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
EF-hand calcium-binding domain-containing protein 4B isoform c
NCBI Official Synonym Full Names
calcium release activated channel regulator 2A
NCBI Official Symbol
CRACR2A
NCBI Official Synonym Symbols
EFCAB4B
NCBI Protein Information
EF-hand calcium-binding domain-containing protein 4B
UniProt Protein Name
EF-hand calcium-binding domain-containing protein 4B
UniProt Gene Name
CRACR2A
UniProt Synonym Gene Names
EFCAB4B; CRAC channel regulator 2A
UniProt Entry Name
EFC4B_HUMAN

Uniprot Description

EFCAB4B: Ca(2+)-binding protein that plays a key role in store- operated Ca(2+) entry (SOCE) in T-cells by regulating CRAC channel activation. Acts as a cytoplasmic calcium-sensor that facilitates the clustering of ORAI1 and STIM1 at the junctional regions between the plasma membrane and the endoplasmic reticulum upon low Ca(2+) concentration. It thereby regulates CRAC channel activation, including translocation and clustering of ORAI1 and STIM1. Upon increase of cytoplasmic Ca(2+) resulting from opening of CRAC channels, dissociates from ORAI1 and STIM1, thereby destabilizing the ORAI1-STIM1 complex. Belongs to the EFCAB4 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Calcium-binding

Chromosomal Location of Human Ortholog: 12p13.32

Cellular Component: Golgi apparatus; membrane; cytoplasm; nucleolus; nucleus

Molecular Function: protein binding; calcium ion binding

Biological Process: activation of store-operated calcium channel activity; immune system process; positive regulation of calcium ion transport

Research Articles on CRACR2A

Similar Products

Product Notes

The CRACR2A cracr2a (Catalog #AAA3209006) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CRACR2A Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CRACR2A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CRACR2A cracr2a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ARKDMQRLHK ELPLSLEELE DVFDALDADG NGYLTPQEFT TGFSHFFFSQ. It is sometimes possible for the material contained within the vial of "CRACR2A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.