Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: HTRA1Sample Tissue: Human Breast Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human HTRA1 Polyclonal Antibody | anti-HTRA1 antibody

HTRA1 Antibody - middle region

Gene Names
HTRA1; L56; HtrA; ARMD7; ORF480; PRSS11; CARASIL; CADASIL2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
HTRA1; Polyclonal Antibody; HTRA1 Antibody - middle region; anti-HTRA1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CQLRAASRRSERLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIADVVEKI
Sequence Length
480
Applicable Applications for anti-HTRA1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human HTRA1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: HTRA1Sample Tissue: Human Breast Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: HTRA1Sample Tissue: Human Breast Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-HTRA1 antibody
This gene encodes a member of the trypsin family of serine proteases. This protein is a secreted enzyme that is proposed to regulate the availability of insulin-like growth factors (IGFs) by cleaving IGF-binding proteins. It has also been suggested to be a regulator of cell growth. Variations in the promoter region of this gene are the cause of susceptibility to age-related macular degeneration type 7.
Product Categories/Family for anti-HTRA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52 kDa
NCBI Official Full Name
serine protease HTRA1
NCBI Official Synonym Full Names
HtrA serine peptidase 1
NCBI Official Symbol
HTRA1
NCBI Official Synonym Symbols
L56; HtrA; ARMD7; ORF480; PRSS11; CARASIL; CADASIL2
NCBI Protein Information
serine protease HTRA1
UniProt Protein Name
Serine protease HTRA1
Protein Family
UniProt Gene Name
HTRA1
UniProt Synonym Gene Names
HTRA; PRSS11
UniProt Entry Name
HTRA1_HUMAN

NCBI Description

This gene encodes a member of the trypsin family of serine proteases. This protein is a secreted enzyme that is proposed to regulate the availability of insulin-like growth factors (IGFs) by cleaving IGF-binding proteins. It has also been suggested to be a regulator of cell growth. Variations in the promoter region of this gene are the cause of susceptibility to age-related macular degeneration type 7. [provided by RefSeq, Jul 2008]

Uniprot Description

HTRA1: Serine protease with a variety of targets, including extracellular matrix proteins such as fibronectin. HTRA1-generated fibronectin fragments further induce synovial cells to up-regulate MMP1 and MMP3 production. May also degrade proteoglycans, such as aggrecan, decorin and fibromodulin. Through cleavage of proteoglycans, may release soluble FGF-glycosaminoglycan complexes that promote the range and intensity of FGF signals in the extracellular space. Regulates the availability of insulin-like growth factors (IGFs) by cleaving IGF-binding proteins. Inhibits signaling mediated by TGF-beta family members. This activity requires the integrity of the catalytic site, although it is unclear whether TGF-beta proteins are themselves degraded. By acting on TGF-beta signaling, may regulate many physiological processes, including retinal angiogenesis and neuronal survival and maturation during development. Intracellularly, degrades TSC2, leading to the activation of TSC2 downstream targets. Variations in the promoter region of HTRA1 are the cause of susceptibility to age-related macular degeneration type 7 (ARMD7). ARMD is the leading cause of vision loss and blindness among older individuals in the developed word. It is classified as either dry (nonneovascular) or wet (neovascular). ARMD7 is a wet form, in which new blood vessels form and break beneath the retina. This leakage causes permanent damage to surrounding retinal tissue, distorting and destroying central vision. Wet ARMD is more prevalent among Asians than Caucasians. Defects in HTRA1 are the cause of cerebral autosomal recessive arteriopathy with subcortical infarcts and leukoencephalopathy (CARASIL). CARASIL is characterized by nonhypertensive cerebral small-vessel arteriopathy with subcortical infarcts, alopecia, and spondylosis, with an onset in early adulthood. On neuropathological examination, atherosclerosis associated with intimal thickening and dense collagen fibers, loss of vascular smooth-muscle cells, and hyaline degeneration of the tunica media has been observed in cerebral small arteries. Belongs to the peptidase S1B family.

Protein type: EC 3.4.21.-; Secreted, signal peptide; Secreted; Protease

Chromosomal Location of Human Ortholog: 10q26.3

Cellular Component: extracellular matrix; extracellular space; cytosol

Molecular Function: insulin-like growth factor binding; serine-type peptidase activity; serine-type endopeptidase activity

Biological Process: negative regulation of defense response to virus; regulation of cell growth; negative regulation of transforming growth factor beta receptor signaling pathway; proteolysis; positive regulation of epithelial cell proliferation; negative regulation of BMP signaling pathway

Disease: Macular Degeneration, Age-related, 7; Cerebral Autosomal Recessive Arteriopathy With Subcortical Infarcts And Leukoencephalopathy

Research Articles on HTRA1

Similar Products

Product Notes

The HTRA1 htra1 (Catalog #AAA3219497) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HTRA1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HTRA1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HTRA1 htra1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CQLRAASRRS ERLHRPPVIV LQRGACGQGQ EDPNSLRHKY NFIADVVEKI. It is sometimes possible for the material contained within the vial of "HTRA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.