Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.29kD).)

Mouse anti-Human DUSP9 Monoclonal Antibody | anti-DUSP9 antibody

DUSP9 (Dual Specificity Protein Phosphatase 9, Mitogen-activated Protein Kinase Phosphatase 4, MAP Kinase Phosphatase 4, MKP-4, MKP4) (HRP)

Gene Names
DUSP9; MKP4; MKP-4
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DUSP9; Monoclonal Antibody; DUSP9 (Dual Specificity Protein Phosphatase 9; Mitogen-activated Protein Kinase Phosphatase 4; MAP Kinase Phosphatase 4; MKP-4; MKP4) (HRP); anti-DUSP9 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2E3
Specificity
Recognizes human DUSP9.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-DUSP9 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa174-278 from human DUSP9 (NP_001386) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AESEADRDSMSCGLDSEGATPPPVGLRASFPVQILPNLYLGSARDSANLESLAKLGIRYILNVTPNLPNFFEKNGDFHYKQIPISDHWSQNLSRFFPEAIEFIDE
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.29kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.29kD).)

Western Blot (WB)

(DUSP9 monoclonal antibody, Western Blot analysis of DUSP9 expression in HeLa.)

Western Blot (WB) (DUSP9 monoclonal antibody, Western Blot analysis of DUSP9 expression in HeLa.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between MAPK3 and DUSP9. HeLa cells were stained with MAPK3 rabbit purified polyclonal 1:1200 and DUSP9 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between MAPK3 and DUSP9. HeLa cells were stained with MAPK3 rabbit purified polyclonal 1:1200 and DUSP9 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-DUSP9 antibody
DUSP9 is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which is associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This DUSP9 shows selectivity for members of the ERK family of MAP kinases, is expressed only in placenta, kidney, and fetal liver, and is localized to the cytoplasm and nucleus.
Product Categories/Family for anti-DUSP9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41,868 Da
NCBI Official Full Name
dual specificity protein phosphatase 9
NCBI Official Synonym Full Names
dual specificity phosphatase 9
NCBI Official Symbol
DUSP9
NCBI Official Synonym Symbols
MKP4; MKP-4
NCBI Protein Information
dual specificity protein phosphatase 9; map kinase phosphatase 4; mitogen-activated protein kinase phosphatase 4; serine/threonine specific protein phosphatase
UniProt Protein Name
Dual specificity protein phosphatase 9
UniProt Gene Name
DUSP9
UniProt Synonym Gene Names
MKP4; MAP kinase phosphatase 4; MKP-4
UniProt Entry Name
DUS9_HUMAN

Uniprot Description

DUSP9: a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (ERK, JNK, p38). Shows selectivity for members of the ERK family, is expressed at high levels in placenta, kidney, and fetal liver, and is localized to the cytoplasm and nucleus.

Protein type: Motility/polarity/chemotaxis; EC 3.1.3.48; EC 3.1.3.16; Protein phosphatase, dual-specificity

Chromosomal Location of Human Ortholog: Xq28

Cellular Component: cytoplasm; nucleus

Molecular Function: protein binding; protein tyrosine/serine/threonine phosphatase activity; protein tyrosine phosphatase activity; MAP kinase tyrosine/serine/threonine phosphatase activity; phosphoprotein phosphatase activity

Biological Process: JNK cascade; protein amino acid dephosphorylation; inactivation of MAPK activity

Similar Products

Product Notes

The DUSP9 dusp9 (Catalog #AAA6152235) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DUSP9 (Dual Specificity Protein Phosphatase 9, Mitogen-activated Protein Kinase Phosphatase 4, MAP Kinase Phosphatase 4, MKP-4, MKP4) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DUSP9 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DUSP9 dusp9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DUSP9, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.