Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-HTR1B Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysate)

Rabbit anti-Human HTR1B Polyclonal Antibody | anti-HTR1B antibody

HTR1B antibody - N-terminal region

Gene Names
HTR1B; S12; 5-HT1B; HTR1D2; HTR1DB; 5-HT-1B; 5-HT1DB; 5-HT-1D-beta
Reactivity
Human
Applications
Western Blot
Purity
Protein A purified
Synonyms
HTR1B; Polyclonal Antibody; HTR1B antibody - N-terminal region; anti-HTR1B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKV
Sequence Length
390
Applicable Applications for anti-HTR1B antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human HTR1B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-HTR1B Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-HTR1B Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-HTR1B antibody
This is a rabbit polyclonal antibody against HTR1B. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The pathophysiology of depression remains enigmatic, although abnormalities that involve serotonin signaling have been implicated. The serotonin 1B receptor [5-hydroxytryptamine (5-HT1B) receptor] interacts with p11. p11 increases localization of 5-HT1B receptors at the cell surface. p11 is increased in rodent brains by antidepressants or electroconvulsive therapy, but decreased in an animal model of depression and in brain tissue from depressed patients. Overexpression of p11 increases 5-HT1B receptor function in cells and recapitulates certain behaviors seen after antidepressant treatment in mice. p11 knockout mice exhibit a depression-like phenotype and have reduced responsiveness to 5-HT1B receptor agonists and reduced behavioral reactions to an antidepressant.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
5-hydroxytryptamine receptor 1B
NCBI Official Synonym Full Names
5-hydroxytryptamine receptor 1B
NCBI Official Symbol
HTR1B
NCBI Official Synonym Symbols
S12; 5-HT1B; HTR1D2; HTR1DB; 5-HT-1B; 5-HT1DB; 5-HT-1D-beta
NCBI Protein Information
5-hydroxytryptamine receptor 1B
UniProt Protein Name
5-hydroxytryptamine receptor 1B
UniProt Gene Name
HTR1B
UniProt Synonym Gene Names
HTR1DB; 5-HT-1B; 5-HT1B
UniProt Entry Name
5HT1B_HUMAN

NCBI Description

The protein encoded by this intronless gene is a G-protein coupled receptor for serotonin (5-hydroxytryptamine). Ligand binding activates second messengers that inhibit the activity of adenylate cyclase and manage the release of serotonin, dopamine, and acetylcholine in the brain. The encoded protein may be involved in several neuropsychiatric disorders and therefore is often a target of antidepressant and other psychotherapeutic drugs. [provided by RefSeq, Nov 2015]

Uniprot Description

5-HT(1B): This is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that inhibit adenylate cyclase activity. Belongs to the G-protein coupled receptor 1 family.

Protein type: Receptor, GPCR; Membrane protein, integral; Membrane protein, multi-pass; GPCR, family 1

Chromosomal Location of Human Ortholog: 6q13

Cellular Component: integral to plasma membrane; cytoplasm; plasma membrane

Molecular Function: serotonin binding; serotonin receptor activity; drug binding

Biological Process: vasoconstriction; drinking behavior; negative regulation of synaptic transmission, glutamatergic; response to mineralocorticoid stimulus; bone remodeling; response to cocaine; regulation of dopamine secretion; negative regulation of serotonin secretion; synaptic transmission; G-protein signaling, coupled to cyclic nucleotide second messenger; negative regulation of cAMP biosynthetic process; response to ethanol; serotonin receptor, adenylate cyclase inhibiting pathway; G-protein coupled receptor internalization; protein kinase C activation; negative regulation of synaptic transmission, GABAergic; regulation of behavior

Research Articles on HTR1B

Similar Products

Product Notes

The HTR1B htr1b (Catalog #AAA3224496) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HTR1B antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HTR1B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HTR1B htr1b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MEEPGAQCAP PPPAGSETWV PQANLSSAPS QNCSAKDYIY QDSISLPWKV. It is sometimes possible for the material contained within the vial of "HTR1B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.