Western Blot (WB)
(Host: RabbitTarget Name: HMCESSample Type: Lung Tumor lysatesAntibody Dilution: 1.0ug/ml)
Rabbit HMCES Polyclonal Antibody | anti-HMCES antibody
HMCES Antibody - N-terminal region
Gene Names
HMCES; DC12; SRAPD1; C3orf37
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity purified
Synonyms
HMCES; Polyclonal Antibody; HMCES Antibody - N-terminal region; anti-HMCES antibody
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GQQRLPEWRDPDKYCPSYNKSPQSNSPVLLSRLHFEKDADSSERIIAPMR
Sequence Length
354
Applicable Applications for anti-HMCES antibody
Western Blot (WB)
Homology
Cow: 85%; Dog: 92%; Horse: 85%; Human: 100%; Mouse: 92%; Pig: 77%; Rabbit: 92%; Rat: 92%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human HMCES
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: HMCESSample Type: Lung Tumor lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: HMCESSample Type: Lung Tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-HMCES antibody
This is a rabbit polyclonal antibody against HMCES. It was validated on Western Blot
Target Description: HMCES specifically binds 5-hydroxymethylcytosine (5hmC)- containing DNA in stem cells, suggesting that it acts as a specific reader of 5hmC in stem cells (By similarity). IT may act as a peptidase; experimental evidences are however required to confirm this prediction.
Target Description: HMCES specifically binds 5-hydroxymethylcytosine (5hmC)- containing DNA in stem cells, suggesting that it acts as a specific reader of 5hmC in stem cells (By similarity). IT may act as a peptidase; experimental evidences are however required to confirm this prediction.
Product Categories/Family for anti-HMCES antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
embryonic stem cell-specific 5-hydroxymethylcytosine-binding protein isoform X1
NCBI Official Synonym Full Names
5-hydroxymethylcytosine binding, ES cell specific
NCBI Official Symbol
HMCES
NCBI Official Synonym Symbols
DC12; SRAPD1; C3orf37
NCBI Protein Information
embryonic stem cell-specific 5-hydroxymethylcytosine-binding protein
UniProt Protein Name
Embryonic stem cell-specific 5-hydroxymethylcytosine-binding protein
UniProt Gene Name
HMCES
UniProt Synonym Gene Names
C3orf37; DC12; SRAPD1; ES cell-specific 5hmC-binding protein
UniProt Entry Name
HMCES_HUMAN
Research Articles on HMCES
Similar Products
Product Notes
The HMCES hmces (Catalog #AAA3213322) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HMCES Antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's HMCES can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HMCES hmces for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GQQRLPEWRD PDKYCPSYNK SPQSNSPVLL SRLHFEKDAD SSERIIAPMR. It is sometimes possible for the material contained within the vial of "HMCES, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
