Western Blot (WB)
(Host: RabbitTarget Name: C10orf131Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit C10orf131 Polyclonal Antibody | anti-C10ORF131 antibody
C10orf131 Antibody - middle region
Gene Names
CC2D2B; C10orf130; C10orf131
Reactivity
Cow, Dog, Human, Pig, Rabbit, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
C10orf131; Polyclonal Antibody; C10orf131 Antibody - middle region; anti-C10ORF131 antibody
Host
Rabbit
Reactivity
Cow, Dog, Human, Pig, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EEEEFMKEFILTDILKVKAADYEDDQEQIKKQKANIFVPSSSPVVNQRKL
Sequence Length
256
Applicable Applications for anti-C10ORF131 antibody
Western Blot (WB)
Homology
Cow: 85%; Dog: 85%; Human: 100%; Pig: 92%; Rabbit: 85%; Rat: 85%; Yeast: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human C10orf131
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: C10orf131Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: C10orf131Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-C10ORF131 antibody
This is a rabbit polyclonal antibody against C10orf131. It was validated on Western Blot
Target Description: The function of this protein remains unknown.
Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-C10ORF131 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
28kDa
NCBI Official Full Name
protein CC2D2B isoform 4
NCBI Official Synonym Full Names
coiled-coil and C2 domain containing 2B
NCBI Official Symbol
CC2D2B
NCBI Official Synonym Symbols
C10orf130; C10orf131
NCBI Protein Information
protein CC2D2B
UniProt Protein Name
Uncharacterized protein C10orf131
UniProt Gene Name
C10orf131
UniProt Entry Name
CJ131_HUMAN
Research Articles on C10ORF131
Similar Products
Product Notes
The C10ORF131 c10orf131 (Catalog #AAA3219061) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C10orf131 Antibody - middle region reacts with Cow, Dog, Human, Pig, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's C10orf131 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the C10ORF131 c10orf131 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EEEEFMKEFI LTDILKVKAA DYEDDQEQIK KQKANIFVPS SSPVVNQRKL. It is sometimes possible for the material contained within the vial of "C10orf131, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
