Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: HIRASample Tissue: Human Neurofibroma Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human HIRA Polyclonal Antibody | anti-HIRA antibody

HIRA Antibody - middle region

Gene Names
HIRA; TUP1; DGCR1; TUPLE1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
HIRA; Polyclonal Antibody; HIRA Antibody - middle region; anti-HIRA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SSLSKRKLELEVETVEKKKKGRPRKDSRLMPVSLSVQSPAALTAEKEAMC
Sequence Length
1017
Applicable Applications for anti-HIRA antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human HIRA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: HIRASample Tissue: Human Neurofibroma Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: HIRASample Tissue: Human Neurofibroma Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-HIRA antibody
This gene encodes a histone chaperone that preferentially places the variant histone H3.3 in nucleosomes. Orthologs of this gene in yeast, flies, and plants are necessary for the formation of transcriptionally silent heterochomatin. This gene plays an important role in the formation of the senescence-associated heterochromatin foci. These foci likely mediate the irreversible cell cycle changes that occur in senescent cells. It is considered the primary candidate gene in some haploinsufficiency syndromes such as DiGeorge syndrome, and insufficient production of the gene may disrupt normal embryonic development.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
111 kDa
NCBI Official Full Name
protein HIRA
NCBI Official Synonym Full Names
histone cell cycle regulator
NCBI Official Symbol
HIRA
NCBI Official Synonym Symbols
TUP1; DGCR1; TUPLE1
NCBI Protein Information
protein HIRA
UniProt Protein Name
Protein HIRA
Protein Family
UniProt Gene Name
HIRA
UniProt Synonym Gene Names
DGCR1; HIR; TUPLE1
UniProt Entry Name
HIRA_HUMAN

NCBI Description

This gene encodes a histone chaperone that preferentially places the variant histone H3.3 in nucleosomes. Orthologs of this gene in yeast, flies, and plants are necessary for the formation of transcriptionally silent heterochomatin. This gene plays an important role in the formation of the senescence-associated heterochromatin foci. These foci likely mediate the irreversible cell cycle changes that occur in senescent cells. It is considered the primary candidate gene in some haploinsufficiency syndromes such as DiGeorge syndrome, and insufficient production of the gene may disrupt normal embryonic development. [provided by RefSeq, Jul 2008]

Uniprot Description

HIRA: a histone chaperone. Necessary to mediate DNA-synthesis-independent nucleosome assembly. Interacts with UBN1, CABIN, and ASF1A in the cell nucleus to form the evolutionarily conserved HUCA histone chaperone complex that deposits the variant histone H3.3 into chromatin in a DNA-replication independent manner. Required for deposition of histone H3.3 at the transcription start sites of genes, where incorporation of histone H3.3 facilitates nucleosome destabilization and contributes to transcriptional activation. Histone H3.3 is also linked to gene silencing and is incorporated into regions of the genome thought to be transcriptionally inactive. While some incorporation of H3.3 into heterochromatin is facilitated by an additional histone chaperone complex containing ATRX and DAXX (ie. telomeric incorporation of H3.3), HIRA is required for incorporation of histone H3.3 and formation of senescence-associated heterochromatin foci (SAHF) during cellular senescence. HIRA is ubiquitously expressed during mouse embryonic development. In the adult mouse, HIRA is expressed at high levels in the kidney, skeletal muscle, and pancreas, but it is expressed at lower levels in the heart, lung, placenta, brain, and liver. A missing copy of the HIRA gene on human chromosome region 22q11.2 is a common characteristic of DiGeorge syndrome patients and insufficient production of the HIRA protein may disrupt normal embryonic development. Two isoforms of the human protein result from alternative splicing.

Protein type: Cell development/differentiation; Transcription regulation; Cell cycle regulation

Chromosomal Location of Human Ortholog: 22q11.21

Cellular Component: nucleoplasm; PML body; protein complex; nuclear chromatin; nucleus

Molecular Function: protein binding; chromatin binding; transcription corepressor activity; transcription factor activity

Biological Process: osteoblast differentiation; regulation of transcription from RNA polymerase II promoter; anatomical structure morphogenesis; muscle cell differentiation; transcription, DNA-dependent; DNA replication-independent nucleosome assembly; gastrulation; chromatin modification

Research Articles on HIRA

Similar Products

Product Notes

The HIRA hira (Catalog #AAA3222326) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HIRA Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HIRA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HIRA hira for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SSLSKRKLEL EVETVEKKKK GRPRKDSRLM PVSLSVQSPA ALTAEKEAMC. It is sometimes possible for the material contained within the vial of "HIRA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.