Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of Rat brain, using HHATL antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 90s.)

Rabbit anti-Human, Rat HHATL Polyclonal Antibody | anti-HHATL antibody

HHATL Rabbit pAb

Gene Names
HHATL; GUP1; OACT3; C3orf3; MBOAT3; MSTP002
Reactivity
Human, Rat
Applications
Western Blot
Purity
Affinity purification
Synonyms
HHATL; Polyclonal Antibody; HHATL Rabbit pAb; C3orf3; GUP1; MBOAT3; MSTP002; OACT3; anti-HHATL antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
WQSGFVTGTFDLQEVLFHGGSSFTVLRCTSFALESCAHPDRHYSLADLLKYNFYLPFFFFGPIMTFDRFHAQVSQVEPVRREGELW
Applicable Applications for anti-HHATL antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 160-245 of human HHATL (NP_065758.3).
Positive Samples
Rat brain
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of Rat brain, using HHATL antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 90s.)

Western Blot (WB) (Western blot analysis of extracts of Rat brain, using HHATL antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 90s.)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56,703 Da
NCBI Official Full Name
protein-cysteine N-palmitoyltransferase HHAT-like protein
NCBI Official Synonym Full Names
hedgehog acyltransferase-like
NCBI Official Symbol
HHATL
NCBI Official Synonym Symbols
GUP1; OACT3; C3orf3; MBOAT3; MSTP002
NCBI Protein Information
protein-cysteine N-palmitoyltransferase HHAT-like protein; glycerol uptake/transporter homolog; hedgehog acyltransferase-like protein; GUP1 glycerol uptake/transporter homolog; membrane bound O-acyltransferase domain containing 3
UniProt Protein Name
Protein-cysteine N-palmitoyltransferase HHAT-like protein
UniProt Gene Name
HHATL
UniProt Synonym Gene Names
C3orf3; GUP1; KIAA1173
UniProt Entry Name
HHATL_HUMAN

Uniprot Description

GUP1: Negatively regulates N-terminal palmitoylation of SHH by HHAT/SKN. Belongs to the membrane-bound acyltransferase family. HHAT subfamily.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 3p22.1

Cellular Component: endoplasmic reticulum membrane; perinuclear region of cytoplasm; endoplasmic reticulum; integral to membrane

Research Articles on HHATL

Similar Products

Product Notes

The HHATL hhatl (Catalog #AAA9142981) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HHATL Rabbit pAb reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HHATL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the HHATL hhatl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: WQSGFVTGTF DLQEVLFHGG SSFTVLRCTS FALESCAHPD RHYSLADLLK YNFYLPFFFF GPIMTFDRFH AQVSQVEPVR REGELW. It is sometimes possible for the material contained within the vial of "HHATL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.