Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Chromatin Immunoprecipitation (ChIP) (Chromatin Immunoprecipitation (ChIP) Using Hdac6 Antibody - C-terminal region and HCT116 Cells)

Rabbit Hdac6 Polyclonal Antibody | anti-HDAC6 antibody

Hdac6 Antibody - C-terminal region

Gene Names
Hdac6; Hd6; Sfc6; Hdac5; mHDA2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Chromatin Immunoprecipitation, Immunoprecipitation, Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
Hdac6; Polyclonal Antibody; Hdac6 Antibody - C-terminal region; anti-HDAC6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VCHHEASEHPLVLSCVDLSTWCYVCQAYVHHEDLQDVKNAAHQNKFGEDM
Sequence Length
1149
Applicable Applications for anti-HDAC6 antibody
Chromatin IP (ChIP), Immunohistochemistry (IHC) Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 86%; Horse: 85%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 86%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Hdac6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Chromatin Immunoprecipitation (ChIP)

(Chromatin Immunoprecipitation (ChIP) Using Hdac6 Antibody - C-terminal region and HCT116 Cells)

Chromatin Immunoprecipitation (ChIP) (Chromatin Immunoprecipitation (ChIP) Using Hdac6 Antibody - C-terminal region and HCT116 Cells)

Immunohistochemistry (IHC)

(Rabbit Anti-Hdac6 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult heartObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

Immunohistochemistry (IHC) (Rabbit Anti-Hdac6 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult heartObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy2/3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

Western Blot (WB)

(Host: MouseTarget Name: HDAC6Sample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: HDAC6Sample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-Hdac6 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Testis)

Western Blot (WB) (WB Suggested Anti-Hdac6 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Testis)
Related Product Information for anti-HDAC6 antibody
This is a rabbit polyclonal antibody against Hdac6. It was validated on Western Blot

Target Description: Hdac6 is responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Hdac6 plays a central role in microtubule-dependent cell motility via deacetylation of tubulin.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
126kDa
NCBI Official Full Name
histone deacetylase 6
NCBI Official Synonym Full Names
histone deacetylase 6
NCBI Official Symbol
Hdac6
NCBI Official Synonym Symbols
Hd6; Sfc6; Hdac5; mHDA2
NCBI Protein Information
histone deacetylase 6
UniProt Protein Name
Histone deacetylase 6
UniProt Gene Name
Hdac6
UniProt Synonym Gene Names
HD6
UniProt Entry Name
HDAC6_MOUSE

Uniprot Description

HDAC6: Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Plays a central role in microtubule-dependent cell motility via deacetylation of tubulin. Interacts with CBFA2T3, HDAC11 and SIRT2. Interacts with F-actin. Interacts with BBIP10. Under proteasome impairment conditions, interacts with UBD via its histone deacetylase 1 and UBP-type zinc-finger regions. Interacts with CYLD. Interacts with ZMYND15. Belongs to the histone deacetylase family. HD type 2 subfamily.

Protein type: Nuclear receptor co-regulator; Deacetylase; Ubiquitin conjugating system; EC 3.5.1.98

Cellular Component: axon; caveola; cell projection; centrosome; cytoplasm; cytoplasmic microtubule; cytosol; dendrite; dynein complex; histone deacetylase complex; inclusion body; leading edge; microtubule; microtubule associated complex; neuron projection; nucleus; perikaryon; perinuclear region of cytoplasm; protein complex

Molecular Function: actin binding; alpha-tubulin binding; beta-catenin binding; beta-tubulin binding; histone deacetylase activity; histone deacetylase binding; Hsp90 protein binding; hydrolase activity; metal ion binding; microtubule binding; misfolded protein binding; NAD-dependent histone deacetylase activity (H3-K14 specific); polyubiquitin binding; protein binding; tau protein binding; tubulin deacetylase activity; ubiquitin binding; ubiquitin protein ligase binding; zinc ion binding

Biological Process: chromatin modification; collateral sprouting; histone deacetylation; intracellular protein transport; lysosome localization; macroautophagy; misfolded or incompletely synthesized protein catabolic process; mitochondrion localization; negative regulation of microtubule depolymerization; negative regulation of protein complex disassembly; negative regulation of proteolysis; positive regulation of signal transduction; protein amino acid deacetylation; protein complex disassembly; protein polyubiquitination; regulation of fat cell differentiation; regulation of gene expression, epigenetic; regulation of protein stability; regulation of receptor activity; regulation of transcription, DNA-dependent; response to misfolded protein; response to organic substance; response to toxin; transcription, DNA-dependent; ubiquitin-dependent protein catabolic process; ubiquitin-dependent protein catabolic process via the multivesicular body pathway

Research Articles on HDAC6

Similar Products

Product Notes

The HDAC6 hdac6 (Catalog #AAA3204243) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Hdac6 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Hdac6 can be used in a range of immunoassay formats including, but not limited to, Chromatin IP (ChIP), Immunohistochemistry (IHC) Western Blot (WB). Researchers should empirically determine the suitability of the HDAC6 hdac6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VCHHEASEHP LVLSCVDLST WCYVCQAYVH HEDLQDVKNA AHQNKFGEDM. It is sometimes possible for the material contained within the vial of "Hdac6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.