Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.42kD).)

Mouse anti-Human HDAC6 Monoclonal Antibody | anti-HDAC6 antibody

HDAC6 (Histone Deacetylase 6, HD6, KIAA0901, JM21) (PE)

Gene Names
HDAC6; HD6; JM21
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HDAC6; Monoclonal Antibody; HDAC6 (Histone Deacetylase 6; HD6; KIAA0901; JM21) (PE); anti-HDAC6 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1E2
Specificity
Recognizes human HDAC6.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-HDAC6 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1128-1215 from HDAC6 (NP_006035) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKNIAHQNKFGEDMPHPH
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.42kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.42kD).)

Western Blot (WB)

(HDAC6 monoclonal antibody Western Blot analysis of HDAC6 expression in HeLa NE)

Western Blot (WB) (HDAC6 monoclonal antibody Western Blot analysis of HDAC6 expression in HeLa NE)

Western Blot (WB)

(Western Blot analysis of HDAC6 expression in transfected 293T cell line by HDAC6 monoclonal antibody Lane 1: HDAC6 transfected lysate (Predicted MW: 131.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of HDAC6 expression in transfected 293T cell line by HDAC6 monoclonal antibody Lane 1: HDAC6 transfected lysate (Predicted MW: 131.4kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-HDAC6 antibody
HDAC6 (histone deacetylase 6) is responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. HDAC6 plays a central role in microtubule-dependent cell motility via deacetylation of tubulin, and has been shown to interact with HDAC11, SIRT2, and F-actin. HDAC6 is ubiquitinated, but its polyubiquitination however does not lead to degradation. HDAC is also a potential target of sumoylation.
Product Categories/Family for anti-HDAC6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
131,419 Da
NCBI Official Full Name
histone deacetylase 6
NCBI Official Synonym Full Names
histone deacetylase 6
NCBI Official Symbol
HDAC6
NCBI Official Synonym Symbols
HD6; JM21
NCBI Protein Information
histone deacetylase 6
UniProt Protein Name
Histone deacetylase 6
UniProt Gene Name
HDAC6
UniProt Synonym Gene Names
KIAA0901; HD6
UniProt Entry Name
HDAC6_HUMAN

NCBI Description

Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to class II of the histone deacetylase/acuc/apha family. It contains an internal duplication of two catalytic domains which appear to function independently of each other. This protein possesses histone deacetylase activity and represses transcription. [provided by RefSeq, Jul 2008]

Uniprot Description

HDAC6: Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Plays a central role in microtubule-dependent cell motility via deacetylation of tubulin. Interacts with CBFA2T3, HDAC11 and SIRT2. Interacts with F-actin. Interacts with BBIP10. Under proteasome impairment conditions, interacts with UBD via its histone deacetylase 1 and UBP-type zinc-finger regions. Interacts with CYLD. Interacts with ZMYND15. Belongs to the histone deacetylase family. HD type 2 subfamily.

Protein type: Nuclear receptor co-regulator; EC 3.5.1.98; Ubiquitin conjugating system; Deacetylase

Chromosomal Location of Human Ortholog: Xp11.23

Cellular Component: microtubule; dendrite; histone deacetylase complex; leading edge; perikaryon; caveola; inclusion body; cytosol; nucleoplasm; dynein complex; microtubule associated complex; cytoplasmic microtubule; axon; perinuclear region of cytoplasm; cytoplasm; nucleus

Molecular Function: zinc ion binding; histone deacetylase binding; microtubule binding; beta-tubulin binding; beta-catenin binding; misfolded protein binding; Hsp90 protein binding; actin binding; protein binding; NAD-dependent histone deacetylase activity (H3-K9 specific); enzyme binding; NAD-dependent histone deacetylase activity (H3-K14 specific); tubulin deacetylase activity; ubiquitin protein ligase binding; NAD-dependent histone deacetylase activity (H4-K16 specific); histone deacetylase activity; polyubiquitin binding; tau protein binding; alpha-tubulin binding

Biological Process: negative regulation of proteolysis; response to misfolded protein; protein polyubiquitination; ubiquitin-dependent protein catabolic process via the multivesicular body pathway; positive regulation of signal transduction; transcription, DNA-dependent; regulation of fat cell differentiation; negative regulation of microtubule depolymerization; macroautophagy; organelle organization and biogenesis; response to toxin; misfolded or incompletely synthesized protein catabolic process; histone deacetylation; regulation of gene expression, epigenetic; response to organic substance; intracellular protein transport; protein complex disassembly; protein amino acid deacetylation; lysosome localization; negative regulation of oxidoreductase activity; regulation of receptor activity; negative regulation of transcription, DNA-dependent; negative regulation of protein complex disassembly

Disease: Chondrodysplasia With Platyspondyly, Distinctive Brachydactyly, Hydrocephaly, And Microphthalmia

Research Articles on HDAC6

Similar Products

Product Notes

The HDAC6 hdac6 (Catalog #AAA6158152) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HDAC6 (Histone Deacetylase 6, HD6, KIAA0901, JM21) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HDAC6 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HDAC6 hdac6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HDAC6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.